Recombinant Mouse Mydgf Protein

Cat.No. : Mydgf-4242M
Product Overview : Purified recombinant protein of Mouse DNA segment, Chr 17, Wayne State University 104, expressed (D17Wsu104e) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was identified in error as interleukin 25. This activity has not been reproducible, however, and the function of this protein is currently unknown.
Molecular Mass : 15.8 kDa
AA Sequence : MVSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL
Endotoxin : < 0.1 ng/μg of protein (< 1 EU/μg)
Purity : > 95% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2
Gene Name Mydgf myeloid derived growth factor [ Mus musculus (house mouse) ]
Official Symbol Mydgf
Synonyms Mydgf; myeloid derived growth factor; Il25; Ly6elg; D17Wsu104; D17Wsu104e; myeloid-derived growth factor; UPF0556 protein C19orf10 homolog
Gene ID 28106
mRNA Refseq NM_080837
Protein Refseq NP_543027
UniProt ID Q9CPT4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Mydgf Products

Required fields are marked with *

My Review for All Mydgf Products

Required fields are marked with *

0
cart-icon
0
compare icon