Recombinant Mouse Mydgf Protein

• Cat.No.: Mydgf-4242M
• Product Overview: Purified recombinant protein of Mouse DNA segment, Chr 17, Wayne State University 104, expressed (D17Wsu104e) without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was identified in error as interleukin 25. This activity has not been reproducible, however, and the function of this protein is currently unknown.
• Molecular Mass: 15.8 kDa
• AA Sequence: MVSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2

Gene Information

• Gene Name: Mydgf myeloid derived growth factor [ Mus musculus (house mouse) ]
• Official Symbol: Mydgf
• Synonyms: Mydgf; myeloid derived growth factor; Il25; Ly6elg; D17Wsu104; D17Wsu104e; myeloid-derived growth factor; UPF0556 protein C19orf10 homolog
• Gene ID: 28106
• mRNA Refseq: NM_080837
• Protein Refseq: NP_543027
• UniProt ID: Q9CPT4