Recombinant Mouse Mydgf Protein

Cat.No. : Mydgf-01M
Product Overview : Recombinant Mouse Mydgf Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 143 amino acids
Description : The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was identified in error as interleukin 25. This activity has not been reproducible, however, and the function of this protein is currently unknown.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Data Not Available.
Molecular Mass : Approximately 15.8 kDa, a single non-glycosylated polypeptide chain containing 143 amino acids.
AA Sequence : MVSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL
Endotoxin : Less than 1 EU/mg of rMuSF20 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 or -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Mydgf myeloid derived growth factor [ Mus musculus (house mouse) ]
Official Symbol Mydgf
Synonyms Mydgf; myeloid derived growth factor; Il25; Ly6elg; D17Wsu104e; myeloid-derived growth factor; UPF0556 protein C19orf10 homolog
Gene ID 28106
mRNA Refseq NM_080837
Protein Refseq NP_543027
UniProt ID Q9CPT4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Mydgf Products

Required fields are marked with *

My Review for All Mydgf Products

Required fields are marked with *

0
cart-icon
0
compare icon