Recombinant Mouse Nanog, TAT-tagged

Cat.No. : Nanog-151M
Product Overview : Recombinant Mouse TAT-Nanog is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Ile305) of Mouse Nanog fused with a TAT tag at the N-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : TAT
AA Sequence : MSVGLPGPHSLPSSEEASNSGNASSMPAVFHPENYSCLQGSATEMLCTEAASPRPSSEDLPLQGS PDSSTSPKQKLSSPEADKGPEEEENKVLARKQKMRTVFSQAQLCALKDRFQKQKYLSLQQMQELS SILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSL SMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYV QLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name Nanog Nanog homeobox [ Mus musculus ]
Official Symbol Nanog
Synonyms NANOG; Nanog homeobox; homeobox protein NANOG; ES cell-associated protein 4; homeobox transcription factor Nanog; early embryo specific expression NK family; early embryo specific expression NK-type homeobox protein; ENK; ecat4; 2410002E02Rik;
Gene ID 71950
mRNA Refseq NM_028016
Protein Refseq NP_082292
Pathway PluriNetWork, organism-specific biosystem; Wnt Signaling Pathway and Pluripotency, organism-specific biosystem;
Function DNA binding; DNA binding; chromatin binding; enhancer sequence-specific DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Nanog Products

Required fields are marked with *

My Review for All Nanog Products

Required fields are marked with *

0

Inquiry Basket

cartIcon