Recombinant Mouse Nanog, TAT-tagged
Cat.No. : | Nanog-151M |
Product Overview : | Recombinant Mouse TAT-Nanog is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Ile305) of Mouse Nanog fused with a TAT tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | TAT |
AA Sequence : | MSVGLPGPHSLPSSEEASNSGNASSMPAVFHPENYSCLQGSATEMLCTEAASPRPSSEDLPLQGS PDSSTSPKQKLSSPEADKGPEEEENKVLARKQKMRTVFSQAQLCALKDRFQKQKYLSLQQMQELS SILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSL SMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYV QLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | Nanog Nanog homeobox [ Mus musculus ] |
Official Symbol | Nanog |
Synonyms | NANOG; Nanog homeobox; homeobox protein NANOG; ES cell-associated protein 4; homeobox transcription factor Nanog; early embryo specific expression NK family; early embryo specific expression NK-type homeobox protein; ENK; ecat4; 2410002E02Rik; |
Gene ID | 71950 |
mRNA Refseq | NM_028016 |
Protein Refseq | NP_082292 |
Pathway | PluriNetWork, organism-specific biosystem; Wnt Signaling Pathway and Pluripotency, organism-specific biosystem; |
Function | DNA binding; DNA binding; chromatin binding; enhancer sequence-specific DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
NANOG-864H | Recombinant Human NANOG | +Inquiry |
NANOG-4923H | Recombinant Human NANOG protein, His-SUMO-tagged | +Inquiry |
NANOG-3604H | Recombinant Human Nanog | +Inquiry |
NANOG-28442TH | Recombinant Human NANOG | +Inquiry |
NANOG-3580H | Recombinant Human NANOG Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NANOG-3981HCL | Recombinant Human NANOG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Nanog Products
Required fields are marked with *
My Review for All Nanog Products
Required fields are marked with *