Recombinant Mouse Nrg4 Protein, Tag Free
Cat.No. : | Nrg4-10M |
Product Overview : | Recombinant Mouse Nrg4 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-62 aa |
Description : | Enables receptor ligand activity. Involved in ERBB4-ERBB4 signaling pathway. Is active in extracellular space. Is expressed in several structures, including embryo mesenchyme; integumental system; pancreas; surface ectoderm; and uterus. Orthologous to human NRG4 (neuregulin 4). |
Tag : | Non |
Molecular Mass : | 7 kDa |
AA Sequence : | MPTDHEQPCGPRHRSFCLNGGICYVIPTIPSPFCRCIENYTGARCEEVFLPSSSIPSESNLS |
Endotoxin : | <1 EU/μg by LAL |
Purity : | > 95% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Lyophilized from PBS, pH 7.4, 5% Mannitol, 5% Trehalose |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.125 mg/mL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents. |
Gene Name | Nrg4 neuregulin 4 [ Mus musculus (house mouse) ] |
Official Symbol | Nrg4 |
Synonyms | NRG4; neuregulin 4; pro-neuregulin-4, membrane-bound isoform; pro-NRG4; AI552600; |
Gene ID | 83961 |
mRNA Refseq | NM_032002 |
Protein Refseq | NP_114391 |
UniProt ID | Q9WTX4 |
◆ Recombinant Proteins | ||
NRG4-18H | Recombinant Human Neuregulin 4, His-tagged | +Inquiry |
Nrg4-01M | Active Recombinant Mouse Nrg4 Protein, GST-tagged | +Inquiry |
Nrg4-02M | Recombinant Mouse neuregulin 4 Protein, His tagged | +Inquiry |
NRG4-07H | Active Recombinant Human NRG4 Protein | +Inquiry |
NRG4-525H | Active Recombinant Human NRG4 | +Inquiry |
◆ Native Proteins | ||
NRG4-1021H | Active Recombinant Human NRG4 Protein, Tag Free | +Inquiry |
NRG4-15H | Active Recombinant Human NRG4 Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRG4-1221HCL | Recombinant Human NRG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Nrg4 Products
Required fields are marked with *
My Review for All Nrg4 Products
Required fields are marked with *