Recombinant Human NRG4 protein, His-tagged
Cat.No. : | NRG4-3043H |
Product Overview : | Recombinant Human NRG4 protein(1-62 aa), fused to His tag, was expressed in E. coli. |
Availability | June 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-62 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NRG4 neuregulin 4 [ Homo sapiens ] |
Official Symbol | NRG4 |
Synonyms | NRG4; neuregulin 4; pro-neuregulin-4, membrane-bound isoform; HRG4; pro-NRG4; heregulin 4; DKFZp779N0541; DKFZp779N1944; |
Gene ID | 145957 |
mRNA Refseq | NM_138573 |
Protein Refseq | NP_612640 |
MIM | 610894 |
UniProt ID | Q8WWG1 |
◆ Recombinant Proteins | ||
Nrg4-01M | Active Recombinant Mouse Nrg4 Protein, GST-tagged | +Inquiry |
Nrg4-12M | Recombinant Mouse neuregulin 4 Protein, His tagged | +Inquiry |
NRG4-2472H | Recombinant human NRG4, His-tagged | +Inquiry |
NRG4-167 | Recombinant NRG4 Protein, GST-tagged | +Inquiry |
NRG4-6200M | Recombinant Mouse NRG4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
NRG4-15H | Active Recombinant Human NRG4 Protein, GST tagged | +Inquiry |
NRG4-1021H | Active Recombinant Human NRG4 Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRG4-1221HCL | Recombinant Human NRG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRG4 Products
Required fields are marked with *
My Review for All NRG4 Products
Required fields are marked with *
0
Inquiry Basket