Recombinant Mouse P2RX4 Protein (55-338 aa), His-SUMO-tagged
| Cat.No. : | P2RX4-2736M |
| Product Overview : | Recombinant Mouse P2RX4 Protein (55-338 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Extracellular Domain. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 55-338 aa |
| Description : | Receptor for ATP that acts as a ligand-gated ion channel. This receptor is insensitive to the antagonists PPADS and suramin (By similarity). |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 47.5 kDa |
| AA Sequence : | QETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPDKTSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDAGVPTPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTDPFCPIFRLGQIVADAGHSFQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMIN |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | P2rx4 purinergic receptor P2X, ligand-gated ion channel 4 [ Mus musculus ] |
| Official Symbol | P2RX4 |
| Synonyms | P2RX4; P2X purinoceptor 4; ATP receptor; ionotropic purinergic receptor; P2X4; AI504491; AW555605; D5Ertd444e; |
| Gene ID | 18438 |
| mRNA Refseq | NM_011026 |
| Protein Refseq | NP_035156 |
| UniProt ID | Q9JJX6 |
| ◆ Recombinant Proteins | ||
| P2rx4-4637M | Recombinant Mouse P2rx4 Protein, Myc/DDK-tagged | +Inquiry |
| P2RX4-1594H | Recombinant Human P2RX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| P2RX4-1755HFL | Recombinant Full Length Human P2RX4 Protein, C-Flag-tagged | +Inquiry |
| P2RX4-4229R | Recombinant Rat P2RX4 Protein | +Inquiry |
| P2RX4-301584H | Recombinant Human P2RX4 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| P2RX4-3499HCL | Recombinant Human P2RX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All P2RX4 Products
Required fields are marked with *
My Review for All P2RX4 Products
Required fields are marked with *



