Recombinant Mouse P2RX4 Protein (55-338 aa), His-SUMO-tagged

Cat.No. : P2RX4-2736M
Product Overview : Recombinant Mouse P2RX4 Protein (55-338 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Extracellular Domain.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 55-338 aa
Description : Receptor for ATP that acts as a ligand-gated ion channel. This receptor is insensitive to the antagonists PPADS and suramin (By similarity).
Form : Tris-based buffer,50% glycerol
Molecular Mass : 47.5 kDa
AA Sequence : QETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPDKTSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDAGVPTPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTDPFCPIFRLGQIVADAGHSFQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMIN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name P2rx4 purinergic receptor P2X, ligand-gated ion channel 4 [ Mus musculus ]
Official Symbol P2RX4
Synonyms P2RX4; P2X purinoceptor 4; ATP receptor; ionotropic purinergic receptor; P2X4; AI504491; AW555605; D5Ertd444e;
Gene ID 18438
mRNA Refseq NM_011026
Protein Refseq NP_035156
UniProt ID Q9JJX6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All P2RX4 Products

Required fields are marked with *

My Review for All P2RX4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon