Recombinant Mouse Pde5a protein, His&Myc-tagged

• Cat.No.: Pde5a-4612M
• Product Overview: Recombinant Mouse Pde5a protein(Q8CG03)(154-320aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 154-320aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.1 kDa
• AA Sequence: DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Pde5a phosphodiesterase 5A, cGMP-specific [ Mus musculus ]
• Official Symbol: Pde5a
• Synonyms: PDE5A; phosphodiesterase 5A, cGMP-specific; cGMP-specific 3,5-cyclic phosphodiesterase; CGB-PDE; cGMP-binding cGMP-specific phosphodiesterase; cGMP-binding/cGMP-specific phosphodiesterase; Cn5n; Pde5; Cgbpde; Pde5a1
• Gene ID: 242202
• mRNA Refseq: NM_153422
• Protein Refseq: NP_700471