| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
76 |
| Description : |
CXCL4 (PF4) is a small cytokine belonging to the CXC chemokine family and it is also known as chemokine (C-X-C motif) ligand 4 (CXCL4). This chemokine is released from alpha-granules of activated platelets during platelet aggregation and neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. CXCL4 interacts with a splice variant of the chemokine receptor CXCR3. Recombinant mouse CXCL4 contains 76 amino acids which is a single non-glycosylated polypeptide chain. Specifically, Human and mouse CXCL4 share about a 60 % identity. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, 1.5 M NaCl, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration of 10-100ng/ml. |
| Molecular Mass : |
Approximately 8.2 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids. |
| AA Sequence : |
VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES |
| Endotoxin : |
Less than 1 EU/μg of rMuPF-4/CXCL4 as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |