"Prl" Related Products

Recombinant Mouse Prl Protein

Cat.No. : Prl-001M
Product Overview : Recombinant mouse Prolactin protein (30-228aa) without tag, was expressed in E.coli and purified by using conventional chromatography techniques.
Description : Prolactin, also known as prl, is a hormone synthesized and secreted by lactotrope cells in the adenohypophysis (anterior pituitary gland). Prolactin has many effects, the most significant of which is to stimulate the mammary glands to produce milk (lactation). Increased serum prolactin during pregnancy causes enlargement of the mammary glands of the breasts and increases the production of milk. Recently, prolactin has demonstrated broader roles in breast cancer development, regulation of reproductive function, and immuno-regulation.
Source : E.coli
Species : Mouse
Form : Liquid
Molecular Mass : 22.7 kDa
AASequence : MQPLPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC
Endotoxin : < 1.0 EU per 1 μg of protein (determined by LAL method)
Purity : > 90% by SDS - PAGE
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1.0 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate buffered saline (pH 7.4)
Warning : For research use only. This product is not intended or approved for human, diagnostics or veterin
SDS-PAGE :

15% SDS-PAGE (3 μg)

Gene Name : Prl prolactin [ Mus musculus (house mouse) ]
Official Symbol : Prl
Synonyms : Prl; prolactin; Gha1; Prl1a1; AV290867; prolactin; growth hormone a1
Gene ID : 19109
mRNA Refseq : NM_011164
Protein Refseq : NP_035294
UniProt ID : Q9CPQ2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.