Recombinant Mouse Retn Protein

Cat.No. : Retn-5466M
Product Overview : Purified recombinant protein of Mouse resistin (Retn), transcript variant 1 without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.
Molecular Mass : 20.2 kDa
AA Sequence : SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS
Endotoxin : < 0.1 ng/μg of protein (< 1 EU/μg)
Purity : > 95% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2
Gene Name Retn resistin [ Mus musculus (house mouse) ]
Official Symbol Retn
Synonyms RETN; resistin; found in inflammatory zone 3; cysteine-rich secreted protein FIZZ3; adipose tissue-specific secretory factor; dominant inhibitory adipocyte-specific secretory factor; adipose-specific cysteine-rich secreted protein A12-alpha; ADSF; Rstn; Xcp4; Fizz3
Gene ID 57264
mRNA Refseq NM_022984
Protein Refseq NP_075360
UniProt ID Q99P87

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Retn Products

Required fields are marked with *

My Review for All Retn Products

Required fields are marked with *

0

Inquiry Basket

cartIcon