Recombinant Mouse Retn Protein
Cat.No. : | Retn-5466M |
Product Overview : | Purified recombinant protein of Mouse resistin (Retn), transcript variant 1 without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes. |
Molecular Mass : | 20.2 kDa |
AA Sequence : | SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Retn resistin [ Mus musculus (house mouse) ] |
Official Symbol | Retn |
Synonyms | RETN; resistin; found in inflammatory zone 3; cysteine-rich secreted protein FIZZ3; adipose tissue-specific secretory factor; dominant inhibitory adipocyte-specific secretory factor; adipose-specific cysteine-rich secreted protein A12-alpha; ADSF; Rstn; Xcp4; Fizz3 |
Gene ID | 57264 |
mRNA Refseq | NM_022984 |
Protein Refseq | NP_075360 |
UniProt ID | Q99P87 |
◆ Recombinant Proteins | ||
RETN-61H | Active Recombinant Human RETN Protein, His-tagged | +Inquiry |
Retn-69R | Recombinant Rat Resistin, His-tagged | +Inquiry |
RETN-29596TH | Recombinant Human RETN | +Inquiry |
RETN-305H | Active Recombinant Human Resistin | +Inquiry |
Retn-5466M | Recombinant Mouse Retn Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RETN-1635MCL | Recombinant Mouse RETN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Retn Products
Required fields are marked with *
My Review for All Retn Products
Required fields are marked with *