Recombinant Mouse S100b protein, His&Myc-tagged
| Cat.No. : | S100b-6312M |
| Product Overview : | Recombinant Mouse S100b protein(P50114)(2-92aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 2-92a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.0 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE |
| Gene Name | S100b S100 protein, beta polypeptide, neural [ Mus musculus ] |
| Official Symbol | S100b |
| Synonyms | S100B; S100 protein, beta polypeptide, neural; protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; Bpb; AI850290; MGC74317; |
| Gene ID | 20203 |
| mRNA Refseq | NM_009115 |
| Protein Refseq | NP_033141 |
| ◆ Recombinant Proteins | ||
| S100B-4065R | Recombinant Rhesus monkey S100B Protein, His-tagged | +Inquiry |
| S100B-4571H | Recombinant Human S100 Calcium Binding Protein B, GST-tagged | +Inquiry |
| S100B-0052H | Recombinant Human S100B Protein | +Inquiry |
| S100B-1703C | Recombinant Canine S100B protein, hFc-tagged | +Inquiry |
| S100b-2570M | Recombinant Mouse S100b protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| S100B-257B | Native Bovine S-100b Protein | +Inquiry |
| S100B-256B | Native Bovine S-100 Protein | +Inquiry |
| S100B-1116H | Native Human S100B Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| S100B-2858HCL | Recombinant Human S100B cell lysate | +Inquiry |
| S100B-1418MCL | Recombinant Mouse S100B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100b Products
Required fields are marked with *
My Review for All S100b Products
Required fields are marked with *
