Recombinant Mouse SLC1A2 Protein (143-238 aa), GST-tagged

Cat.No. : SLC1A2-813M
Product Overview : Recombinant Mouse SLC1A2 Protein (143-238 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : GST
Protein Length : 143-238 aa
Description : Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly roving released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 37.6 kDa
AA Sequence : HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name Slc1a2 solute carrier family 1 (glial high affinity glutamate transporter), member 2 [ Mus musculus ]
Official Symbol SLC1A2
Synonyms SLC1A2; GLT1; Eaat2; GLT-1; MGLT1; AI159670; 1700091C19Rik; 2900019G14Rik;
Gene ID 20511
mRNA Refseq NM_001077514
Protein Refseq NP_001070982
UniProt ID P43006

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC1A2 Products

Required fields are marked with *

My Review for All SLC1A2 Products

Required fields are marked with *

0
cart-icon