Recombinant Mouse SPRR2B Protein (1-98 aa), His-Myc-tagged

• Cat.No.: SPRR2B-2592M
• Product Overview: Recombinant Mouse SPRR2B Protein (1-98 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-98 aa
• Description: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 17.7 kDa
• AA Sequence: MSYYQQQCKQPCQPPPVCPPPKCPEPCPPPKCPEPCPPPVCCEPCPPPKCPEPCPPPVCCEPCPPPVCCEPCPPQPWQPKCPPVQFPPCQQKCPPKNK
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Sprr2b small proline-rich protein 2B [ Mus musculus (house mouse) ]
• Official Symbol: SPRR2B
• Synonyms: Sprr2b
• Gene ID: 20756
• UniProt ID: O70554