Recombinant Human SPRR2B Protein (1-72 aa), His-Myc-tagged
Cat.No. : | SPRR2B-2219H |
Product Overview : | Recombinant Human SPRR2B Protein (1-72 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His&Myc |
Protein Length : | 1-72 aa |
Description : | Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 12.0 kDa |
AA Sequence : | MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | SPRR2B small proline rich protein 2B [ Homo sapiens (human) ] |
Official Symbol | SPRR2B |
Synonyms | SPRR2B; |
Gene ID | 6701 |
mRNA Refseq | NM_001017418 |
Protein Refseq | NP_001017418 |
UniProt ID | P35325 |
◆ Recombinant Proteins | ||
SPRR2B-2219H | Recombinant Human SPRR2B Protein (1-72 aa), His-Myc-tagged | +Inquiry |
SPRR2B-2752M | Recombinant Mouse SPRR2B Protein (1-98 aa), His-Myc-tagged | +Inquiry |
SPRR2B-3818H | Recombinant Human SPRR2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPRR2B-2592M | Recombinant Mouse SPRR2B Protein (1-98 aa), His-Myc-tagged | +Inquiry |
SPRR2B-2678H | Recombinant Human SPRR2B Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPRR2B Products
Required fields are marked with *
My Review for All SPRR2B Products
Required fields are marked with *
0
Inquiry Basket