Recombinant Human SPRR2B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPRR2B-3818H |
Product Overview : | SPRR2B MS Standard C13 and N15-labeled recombinant protein (NP_001017418) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. |
Molecular Mass : | 8 kDa |
AA Sequence : | MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPRR2B small proline rich protein 2B [ Homo sapiens (human) ] |
Official Symbol | SPRR2B |
Synonyms | SPRR2B; small proline rich protein 2B; small proline-rich protein 2B; SPR-2B |
Gene ID | 6701 |
mRNA Refseq | NM_001017418 |
Protein Refseq | NP_001017418 |
MIM | 182268 |
UniProt ID | P35325 |
◆ Recombinant Proteins | ||
SPRR2B-2219H | Recombinant Human SPRR2B Protein (1-72 aa), His-Myc-tagged | +Inquiry |
SPRR2B-2752M | Recombinant Mouse SPRR2B Protein (1-98 aa), His-Myc-tagged | +Inquiry |
SPRR2B-3818H | Recombinant Human SPRR2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPRR2B-2592M | Recombinant Mouse SPRR2B Protein (1-98 aa), His-Myc-tagged | +Inquiry |
SPRR2B-2678H | Recombinant Human SPRR2B Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPRR2B Products
Required fields are marked with *
My Review for All SPRR2B Products
Required fields are marked with *