Recombinant Human SPRR2B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPRR2B-3818H
Product Overview : SPRR2B MS Standard C13 and N15-labeled recombinant protein (NP_001017418) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
Molecular Mass : 8 kDa
AA Sequence : MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPRR2B small proline rich protein 2B [ Homo sapiens (human) ]
Official Symbol SPRR2B
Synonyms SPRR2B; small proline rich protein 2B; small proline-rich protein 2B; SPR-2B
Gene ID 6701
mRNA Refseq NM_001017418
Protein Refseq NP_001017418
MIM 182268
UniProt ID P35325

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPRR2B Products

Required fields are marked with *

My Review for All SPRR2B Products

Required fields are marked with *

0
cart-icon