Recombinant Mouse SPRR2B Protein (1-98 aa), His-Myc-tagged
| Cat.No. : | SPRR2B-2752M |
| Product Overview : | Recombinant Mouse SPRR2B Protein (1-98 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Insect Cells |
| Tag : | His&Myc |
| Protein Length : | 1-98 aa |
| Description : | Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 14.7 kDa |
| AA Sequence : | MSYYQQQCKQPCQPPPVCPPPKCPEPCPPPKCPEPCPPPVCCEPCPPPKCPEPCPPPVCCEPCPPPVCCEPCPPQPWQPKCPPVQFPPCQQKCPPKNK |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Sprr2b small proline-rich protein 2B [ Mus musculus (house mouse) ] |
| Official Symbol | SPRR2B |
| Synonyms | Sprr2b; |
| Gene ID | 20756 |
| UniProt ID | O70554 |
| ◆ Recombinant Proteins | ||
| SPRR2B-2592M | Recombinant Mouse SPRR2B Protein (1-98 aa), His-Myc-tagged | +Inquiry |
| SPRR2B-2752M | Recombinant Mouse SPRR2B Protein (1-98 aa), His-Myc-tagged | +Inquiry |
| SPRR2B-2219H | Recombinant Human SPRR2B Protein (1-72 aa), His-Myc-tagged | +Inquiry |
| SPRR2B-2678H | Recombinant Human SPRR2B Protein, MYC/DDK-tagged | +Inquiry |
| SPRR2B-3818H | Recombinant Human SPRR2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPRR2B Products
Required fields are marked with *
My Review for All SPRR2B Products
Required fields are marked with *



