Recombinant Mouse Tigit Protein, Fc-tagged

Cat.No. : Tigit-731M
Product Overview : Recombinant Mouse Tigit protein with Fc tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : Fc
Protein Length : 241
Description : Enables signaling receptor binding activity. Acts upstream of or within negative regulation of T cell activation. Predicted to be active in cell surface. Orthologous to human TIGIT (T cell immunoreceptor with Ig and ITIM domains).
Form : Lyophilized
Molecular Mass : 40 kDa
AA Sequence : MHGWLLLVWVQGLIQAAFLATGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLGGTMAAVLGLICLMVTGVTVLARKKSIRMHSIESGLGRTEAEPQEWNLRSLSSPGSPVQTQTAPAGPCGEQAEDDYADPQEYFNVLSYRSLESFIAVSKTG
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Tigit T cell immunoreceptor with Ig and ITIM domains [ Mus musculus (house mouse) ]
Official Symbol Tigit
Synonyms TIGIT; T cell immunoreceptor with Ig and ITIM domains; T-cell immunoreceptor with Ig and ITIM domains; V-set and transmembrane domain containing 3; V-set and transmembrane domain-containing protein 3; Vstm3; ENSMUSG00000071552;
Gene ID 100043314
mRNA Refseq NM_001146325
Protein Refseq NP_001139797
UniProt ID https://www.uniprot.org/uniprot/A0A0B4J1G6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tigit Products

Required fields are marked with *

My Review for All Tigit Products

Required fields are marked with *

0
cart-icon