Recombinant Mouse Timp1 protein, His-SUMO-tagged
Cat.No. : | Timp1-3583M |
Product Overview : | Recombinant Mouse Timp1 protein(P12032)(25-205aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 25-205aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.2 kDa |
AA Sequence : | CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Timp1 tissue inhibitor of metalloproteinase 1 [ Mus musculus ] |
Official Symbol | Timp1 |
Synonyms | TIMP1; tissue inhibitor of metalloproteinase 1; metalloproteinase inhibitor 1; EPA; TPA-S1; TPA-induced protein; erythroid-potentiating activity; collagenase inhibitor 16C8 fibroblast; tissue inhibitor of metalloproteinase-1; tissue inhibitor of metalloproteinases 1; Clgi; Timp; TIMP-1; MGC7143; |
Gene ID | 21857 |
mRNA Refseq | NM_001044384 |
Protein Refseq | NP_001037849 |
◆ Recombinant Proteins | ||
TIMP1-4491H | Recombinant Human TIMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TIMP1-2789S | Recombinant Sheep TIMP1 protein, His & T7-tagged | +Inquiry |
TIMP1-30304TH | Recombinant Human TIMP1, His-tagged | +Inquiry |
Timp1-3583M | Recombinant Mouse Timp1 protein, His-SUMO-tagged | +Inquiry |
Timp1-410R | Recombinant Rat Timp1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TIMP1-92H | Native Human TIMP-1 | +Inquiry |
TIMP1-30840TH | Native Human TIMP1 | +Inquiry |
TIMP1-91B | Active Native Bovine Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIMP1-1490RCL | Recombinant Rat TIMP1 cell lysate | +Inquiry |
TIMP1-2376MCL | Recombinant Mouse TIMP1 cell lysate | +Inquiry |
TIMP1-2678HCL | Recombinant Human TIMP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Timp1 Products
Required fields are marked with *
My Review for All Timp1 Products
Required fields are marked with *
0
Inquiry Basket