Recombinant Mouse Timp1 protein, His-SUMO-tagged
| Cat.No. : | Timp1-3583M |
| Product Overview : | Recombinant Mouse Timp1 protein(P12032)(25-205aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 25-205aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 36.2 kDa |
| AA Sequence : | CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Timp1 tissue inhibitor of metalloproteinase 1 [ Mus musculus ] |
| Official Symbol | Timp1 |
| Synonyms | TIMP1; tissue inhibitor of metalloproteinase 1; metalloproteinase inhibitor 1; EPA; TPA-S1; TPA-induced protein; erythroid-potentiating activity; collagenase inhibitor 16C8 fibroblast; tissue inhibitor of metalloproteinase-1; tissue inhibitor of metalloproteinases 1; Clgi; Timp; TIMP-1; MGC7143; |
| Gene ID | 21857 |
| mRNA Refseq | NM_001044384 |
| Protein Refseq | NP_001037849 |
| ◆ Recombinant Proteins | ||
| Timp1-1798R | Recombinant Rat TIMP Metallopeptidase Inhibitor 1 | +Inquiry |
| TIMP1-3194H | Active Recombinant Human TIMP1 protein | +Inquiry |
| TIMP1-409H | Recombinant Human TIMP1 Protein, His-tagged | +Inquiry |
| Timp1-61R | Recombinant Rat Timp1 protein, His-tagged | +Inquiry |
| TIMP1-4764H | Recombinant Human TIMP1 protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| TIMP1-91B | Active Native Bovine Thrombin | +Inquiry |
| TIMP1-92H | Native Human TIMP-1 | +Inquiry |
| TIMP1-30840TH | Native Human TIMP1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TIMP1-1490RCL | Recombinant Rat TIMP1 cell lysate | +Inquiry |
| TIMP1-2376MCL | Recombinant Mouse TIMP1 cell lysate | +Inquiry |
| TIMP1-2678HCL | Recombinant Human TIMP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Timp1 Products
Required fields are marked with *
My Review for All Timp1 Products
Required fields are marked with *
