Recombinant Mouse TIMP4 Protein (30-224 aa), His-tagged
| Cat.No. : | TIMP4-832B |
| Product Overview : | Recombinant Mouse TIMP4 Protein (30-224 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 30-224 aa |
| Description : | Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 26.5 kDa |
| AA Sequence : | CSCAPAHPQQHVCHSALAIRAKISSEKVVPASTDPADPQKMIRYEIKQIKMFKGFEKVNDIQYIYTPFDSSLCGVKLEANSQKRYLLTGQILSDGKVFVHLCNYIEPWENLSFLQRESLNHHYHLNCGCQITTCYAVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGSCSWYQGRLPLRKEFVDIIQP |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | Timp4 tissue inhibitor of metalloproteinase 4 [ Mus musculus ] |
| Official Symbol | TIMP4 |
| Synonyms | TIMP4; metalloproteinase inhibitor 4; TIMP-4; |
| Gene ID | 110595 |
| mRNA Refseq | NM_080639 |
| Protein Refseq | NP_542370 |
| UniProt ID | O97563 |
| ◆ Recombinant Proteins | ||
| TIMP4-832B | Recombinant Mouse TIMP4 Protein (30-224 aa), His-tagged | +Inquiry |
| TIMP4-3242H | Recombinant Human TIMP4, GST-tagged | +Inquiry |
| TIMP4-4538R | Recombinant Rhesus Macaque TIMP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TIMP4-3244H | Active Recombinant Human TIMP4, HIgG1 Fc-tagged | +Inquiry |
| TIMP4-3111H | Recombinant Human TIMP4 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TIMP4-1063HCL | Recombinant Human TIMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIMP4 Products
Required fields are marked with *
My Review for All TIMP4 Products
Required fields are marked with *
