Recombinant Mouse Tnf protein, His-SUMO-tagged
| Cat.No. : | Tnf-3598M |
| Product Overview : | Recombinant Mouse Tnf protein(P06804)(57-235aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 57-235aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 35.7 kDa |
| AA Sequence : | GPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Tnf tumor necrosis factor [ Mus musculus ] |
| Official Symbol | Tnf |
| Synonyms | TNF; tumor necrosis factor; TNF-a; TNF alpha; cachectin; tumor necrosis factor alpha; tumor necrosis factor-alpha; tumor necrosis factor ligand superfamily member 2; DIF; Tnfa; TNFSF2; Tnfsf1a; TNFalpha; TNF-alpha; MGC151434; |
| Gene ID | 21926 |
| mRNA Refseq | NM_013693 |
| Protein Refseq | NP_038721 |
| ◆ Recombinant Proteins | ||
| TNF-1022F | Recombinant Ferret TNF protein(Val77-Leu233) | +Inquiry |
| TNF-251R | Active Recombinant Rat TNF Protein | +Inquiry |
| Tnf-308P | Active Recombinant Guinea Pig Tnf | +Inquiry |
| Tnf-7357M | Recombinant Mouse Tnf Protein | +Inquiry |
| TNF-79P | Recombinant Porcine Tumor Necrosis Factor-Alpha, biologically active | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNF-897HCL | Recombinant Human TNF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnf Products
Required fields are marked with *
My Review for All Tnf Products
Required fields are marked with *
