Recombinant Mouse Tslp protein, FC-tagged
Cat.No. : | Tslp-469M |
Product Overview : | Recombinant Mouse Tslp(Gln67-Ser225) fused with FC tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | Gln67-Ser225 |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4 |
AA Sequence : | YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDK TFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPEVDDIEGRMD EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 21 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 19X PBS.Please aliquot the reconstituted solution. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | Tslp thymic stromal lymphopoietin [ Mus musculus ] |
Official Symbol | Tslp |
Synonyms | TSLP; thymic stromal lymphopoietin; thymic stroma-derived lymphopoietin; |
Gene ID | 53603 |
mRNA Refseq | NM_021367 |
Protein Refseq | NP_067342 |
MIM | |
UniProt ID | Q9JIE6 |
Chromosome Location | 18 B1; 18 18.12 Cm |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
Function | cytokine activity; |
◆ Recombinant Proteins | ||
TSLP-138H | Recombinant Human TSLP Protein, His-tagged, R127A, R130S | +Inquiry |
TSLP-5742C | Recombinant Cynomolgus TSLP protein, His-tagged, Biotinylated, Primary Amine Labeling | +Inquiry |
TSLP-8307H | Recombinant Human TSLP | +Inquiry |
TSLP-2335H | Recombinant Human TSLP protein(R127A, R130S), hFc-tagged | +Inquiry |
Tslp-501M | Recombinant Mouse Tslp Protein, His&SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSLP-1742MCL | Recombinant Mouse TSLP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tslp Products
Required fields are marked with *
My Review for All Tslp Products
Required fields are marked with *