Recombinant Mouse Vasp protein
Cat.No. : | Vasp-4910M |
Product Overview : | Recombinant Mouse Vasp protein(P70460)(2-375 aa) was expressed in Mammalian Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Mammalian Cells |
Tag : | Non |
Protein Length : | 2-375 aa |
Form : | Tris/PBS-based buffer, 6% Trehalose. |
AASequence : | SETVICSSRATVMLYDDSNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVV INCAIIRGVKYNQATPIFHQWRDARQVWGLNFGSKEDAIQFATGMANALEALEGGGPPPA PAPPAWSAQNGPSPEELEQQKRQPEHMERRVSNAGGPPAPPAGGPPPPPGPPPPPGPPPP PGLPSSGVSGAGHGAGAAPPPAPPLPTAQGPNSGGSGAPGLAAAIAGAKLRKVSKQEEAS GGPLAPKAENSRSTGGGLMEEMNAMLARRRKATQVGEKPPKDESASEESEARLPAQSEPV RRPWEKNSTTLPRMKSSSSVTTSEAHPSTPCSSDDSDLERVKQELLEEVRKELQKMKEEI IEVFVQELRKRGSP |
Purity : | >85% (SDS-PAGE) |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | Vasp vasodilator-stimulated phosphoprotein [ Mus musculus ] |
Official Symbol | Vasp |
Synonyms | VASP; vasodilator-stimulated phosphoprotein; AA107290; |
Gene ID | 22323 |
mRNA Refseq | NM_009499 |
Protein Refseq | NP_033525 |
◆ Recombinant Proteins | ||
Vasp-6901M | Recombinant Mouse Vasp Protein, Myc/DDK-tagged | +Inquiry |
VASP-1570H | Recombinant Human VASP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
VASP-1409HFL | Recombinant Full Length Human VASP Protein, C-Flag-tagged | +Inquiry |
Vasp-4908M | Recombinant Mouse Vasp protein, Avi-tagged, Biotinylated | +Inquiry |
VASP-17986M | Recombinant Mouse VASP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
VASP-426HCL | Recombinant Human VASP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Vasp Products
Required fields are marked with *
My Review for All Vasp Products
Required fields are marked with *