Recombinant Mouse Vasp protein
| Cat.No. : | Vasp-4910M | 
| Product Overview : | Recombinant Mouse Vasp protein(P70460)(2-375 aa) was expressed in Mammalian Cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse | 
| Source : | Mammalian Cells | 
| Tag : | Non | 
| Protein Length : | 2-375 aa | 
| Form : | Tris/PBS-based buffer, 6% Trehalose. | 
| AASequence : | SETVICSSRATVMLYDDSNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVV INCAIIRGVKYNQATPIFHQWRDARQVWGLNFGSKEDAIQFATGMANALEALEGGGPPPA PAPPAWSAQNGPSPEELEQQKRQPEHMERRVSNAGGPPAPPAGGPPPPPGPPPPPGPPPP PGLPSSGVSGAGHGAGAAPPPAPPLPTAQGPNSGGSGAPGLAAAIAGAKLRKVSKQEEAS GGPLAPKAENSRSTGGGLMEEMNAMLARRRKATQVGEKPPKDESASEESEARLPAQSEPV RRPWEKNSTTLPRMKSSSSVTTSEAHPSTPCSSDDSDLERVKQELLEEVRKELQKMKEEI IEVFVQELRKRGSP | 
| Purity : | >85% (SDS-PAGE) | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. | 
| Gene Name | Vasp vasodilator-stimulated phosphoprotein [ Mus musculus ] | 
| Official Symbol | Vasp | 
| Synonyms | VASP; vasodilator-stimulated phosphoprotein; AA107290; | 
| Gene ID | 22323 | 
| mRNA Refseq | NM_009499 | 
| Protein Refseq | NP_033525 | 
| ◆ Recombinant Proteins | ||
| Vasp-6901M | Recombinant Mouse Vasp Protein, Myc/DDK-tagged | +Inquiry | 
| VASP-1570H | Recombinant Human VASP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| VASP-1409HFL | Recombinant Full Length Human VASP Protein, C-Flag-tagged | +Inquiry | 
| Vasp-4908M | Recombinant Mouse Vasp protein, Avi-tagged, Biotinylated | +Inquiry | 
| VASP-17986M | Recombinant Mouse VASP Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| VASP-426HCL | Recombinant Human VASP 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Vasp Products
Required fields are marked with *
My Review for All Vasp Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            