Recombinant Pig HSP90AA1 Protein, His-tagged

Cat.No. : HSP90AA1-1246P
Product Overview : Recombinant Pig HSP90AA1 Protein (222-367aa) was expressed in Baculovirus with N-terminal His-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pig
Source : Insect Cells
Tag : His
Protein Length : 222-367 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 19.7 kDa
AA Sequence : VEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEEL
NKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN
IKLYVR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name HSP90AA1 heat shock protein 90 alpha family class A member 1 [ Sus scrofa (pig) ]
Official Symbol HSP90AA1
Synonyms HSP90; Hspca; HSP90AA1; heat shock protein 90 alpha family class A member 1; 90-kDa heat shock protein; heat shock protein HSP 90-alpha
Gene ID 397028
mRNA Refseq NM_213973.2
Protein Refseq NP_999138.1
UniProt ID O02705

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSP90AA1 Products

Required fields are marked with *

My Review for All HSP90AA1 Products

Required fields are marked with *

0
cart-icon