"HSP90AA1" Related Products

Expand
Expand
Expand

Recombinant Pig HSP90AA1 Protein, His-tagged

Cat.No. : HSP90AA1-1246P
Product Overview : Recombinant Pig HSP90AA1 Protein (222-367aa) was expressed in Baculovirus with N-terminal His-tag.
Source : Insect cell
Species : Pig
Tag : His
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 19.7 kDa
AA Sequence : VEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEEL
NKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN
IKLYVR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Figure :

Gene Name : HSP90AA1 heat shock protein 90 alpha family class A member 1 [ Sus scrofa (pig) ]
Official Symbol : HSP90AA1
Synonyms : HSP90; Hspca; HSP90AA1; heat shock protein 90 alpha family class A member 1; 90-kDa heat shock protein; heat shock protein HSP 90-alpha
Gene ID : 397028
mRNA Refseq : NM_213973.2
Protein Refseq : NP_999138.1
UniProt ID : O02705

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.