Recombinant Pig HSP90AA1 Protein, His-tagged
Cat.No. : | HSP90AA1-1246P |
Product Overview : | Recombinant Pig HSP90AA1 Protein (222-367aa) was expressed in Baculovirus with N-terminal His-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 222-367 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 19.7 kDa |
AA Sequence : | VEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEEL NKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN IKLYVR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | HSP90AA1 heat shock protein 90 alpha family class A member 1 [ Sus scrofa (pig) ] |
Official Symbol | HSP90AA1 |
Synonyms | HSP90; Hspca; HSP90AA1; heat shock protein 90 alpha family class A member 1; 90-kDa heat shock protein; heat shock protein HSP 90-alpha |
Gene ID | 397028 |
mRNA Refseq | NM_213973.2 |
Protein Refseq | NP_999138.1 |
UniProt ID | O02705 |
◆ Recombinant Proteins | ||
HSP90AA1-05H | Recombinant Human HSP90AA1 protein, His-tagged | +Inquiry |
HSP90AA1-01H | Recombinant Human HSP90AA1 protein, His-SUMO-tagged | +Inquiry |
HSP90AA1-03H | Recombinant Human HSP90AA1 protein, His-tagged | +Inquiry |
HSP90AA1-227H | Recombinant Human HSP90AA1 | +Inquiry |
HSP90AA1-3055H | Recombinant Human HSP90AA1 protein, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
HSP90AA1-14H | Native Hsp90 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSP90AA1-5362HCL | Recombinant Human HSP90AA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSP90AA1 Products
Required fields are marked with *
My Review for All HSP90AA1 Products
Required fields are marked with *