Recombinant Pig IL2 protein

Cat.No. : IL2-600P
Product Overview : Recombinant Pig IL2 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pig
Source : E.coli
Tag : Non
Protein Length : 134
Description : IL-2 is a powerful immunoregulatory lymphokine produced by T-cells in response to antigenic or mitogenic stimulation. It is expressed by CD4+ and CD8+ T cells, γδ T cells, B cells, dendritic cells, and eosinophils. IL-2/IL-2R signaling is required for T-cell proliferation and other fundamental functions which are essential for the immune response. The receptor for IL-2 consists of three subunits (55 kDa IL2Rα, 75 kDa IL2Rβ, 64 kDa common gamma chain γc/IL2Rγ) that are present on the cell surface in varying preformed complexes. Recombinant porcine IL-2 is a 15.3 kDa protein containing 134 amino acid residues and it shares about 72 % amino acid sequence identity with mouse, human and rat IL-2. It also shares 60 % and 67 % acid sequence identity with rhesus macaque and equus caballus IL-2, respectively.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 1 × PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine CTLL-2 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
Molecular Mass : Approximately 15.2 kDa, a single non-glycosylated polypeptide chain containing 134 amino acids.
AA Sequence : APTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKGSETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT
Endotoxin : Less than 1 EU/μg of rPoIL-2 as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name IL2
Official Symbol IL2
Synonyms IL2; interleukin 2; interleukin-2; T-cell growth factor; IL-2; TCGF; POIL2;
Gene ID 396868
mRNA Refseq NM_213861
Protein Refseq NP_999026
UniProt ID P26891

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL2 Products

Required fields are marked with *

My Review for All IL2 Products

Required fields are marked with *

0
cart-icon