Recombinant Pig IL23A Full Length Transmembrane protein, His&Myc-tagged

Cat.No. : IL23A-1327P
Product Overview : Recombinant Pig IL23A protein(Q9N2H9)(23-193aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pig
Source : E.coli
Tag : His&Myc
Protein Length : 23-193aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 26.1 kDa
AA Sequence : RAVPEGSSPAWAQGQQLSQQLCTLAWTAHLPMGHVDLPREEGDDETTSEVPHIQCGDGCDPQGLRDNSQSCLQRIHQGLVFYEKLLGSDIFTGEPSLHPDGSVGQLHASLLGLRQLLQPEGHHWETEQTPSPSPSQPWQRLLLRLKILRSLQAFVAVAARVFAHGAATLSQ
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name IL23A interleukin 23, alpha subunit p19 [ Sus scrofa ]
Official Symbol IL23A
Synonyms IL23A; interleukin 23, alpha subunit p19; interleukin-23 subunit alpha; IL-23-A; IL-23p19; IL-23 subunit alpha; interleukin 23 p19 subunit; interleukin-23 subunit p19; SGRF; il23p19;
Gene ID 100155546
mRNA Refseq NM_001130236
Protein Refseq NP_001123708

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (1)

Customer Reviews

Write a review

Q&As

Ask a question

Is this bioactive cyno IL-23 heterodimer (p19/p40) or just the cyno IL-23p19 subunit? 02/01/2023

Please inquiry our product manager with specific product.

Ask a Question for All IL23A Products

Required fields are marked with *

My Review for All IL23A Products

Required fields are marked with *

0
cart-icon
0
compare icon