Recombinant Pig IL23A Full Length Transmembrane protein, His&Myc-tagged
| Cat.No. : | IL23A-1327P |
| Product Overview : | Recombinant Pig IL23A protein(Q9N2H9)(23-193aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pig |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 23-193aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 26.1 kDa |
| AA Sequence : | RAVPEGSSPAWAQGQQLSQQLCTLAWTAHLPMGHVDLPREEGDDETTSEVPHIQCGDGCDPQGLRDNSQSCLQRIHQGLVFYEKLLGSDIFTGEPSLHPDGSVGQLHASLLGLRQLLQPEGHHWETEQTPSPSPSQPWQRLLLRLKILRSLQAFVAVAARVFAHGAATLSQ |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | IL23A interleukin 23, alpha subunit p19 [ Sus scrofa ] |
| Official Symbol | IL23A |
| Synonyms | IL23A; interleukin 23, alpha subunit p19; interleukin-23 subunit alpha; IL-23-A; IL-23p19; IL-23 subunit alpha; interleukin 23 p19 subunit; interleukin-23 subunit p19; SGRF; il23p19; |
| Gene ID | 100155546 |
| mRNA Refseq | NM_001130236 |
| Protein Refseq | NP_001123708 |
| ◆ Recombinant Proteins | ||
| Il23a-651M | Active Recombinant Mouse Interleukin 23, Alpha Subunit P19 | +Inquiry |
| IL23A-179H | Recombinant Active Human IL23A Protein, His-tagged(N-ter) | +Inquiry |
| IL23A-1172H | Recombinant Human IL23A Protein, His (Fc)-Avi-tagged | +Inquiry |
| Il23A-23H | Recombinant Human Il23A&IL12B Protein, His-tagged | +Inquiry |
| IL23A-4844H | Recombinant Human IL23A Protein, MBP&His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL23A-5231HCL | Recombinant Human IL23A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All IL23A Products
Required fields are marked with *
My Review for All IL23A Products
Required fields are marked with *


