Recombinant Pig PF4 protein, His&Myc-tagged
| Cat.No. : | PF4-7432P |
| Product Overview : | Recombinant Pig PF4 protein(P30034)(1-90aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pig |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-90aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.1 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | QEWSLPGTRVPPPADPEGGDANLRCVCVKTISGVSPKHISSLEVIGAGPHCPSPQLIATLKKGHKICLDPQNLLYKKIIKKLLKSQLLTA |
| ◆ Recombinant Proteins | ||
| PF4-151H | Recombinant Human PF4 Protein, DYKDDDDK-tagged | +Inquiry |
| PF4-4048R | Recombinant Rat PF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PF4-1181H | Recombinant Horse PF4 Protein, His-tagged | +Inquiry |
| PF4-590H | Recombinant Human platelet factor 4, His-tagged | +Inquiry |
| PF4-1654H | Recombinant Human PF4, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| PF4-253H | Native Human Platelet Factor 4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PF4-3283HCL | Recombinant Human PF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PF4 Products
Required fields are marked with *
My Review for All PF4 Products
Required fields are marked with *
