Recombinant Pig VEGFA protein, His-tagged
| Cat.No. : | VEGFA-3652P |
| Product Overview : | Recombinant Pig VEGFA protein(P49151)(27-190aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pig |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 27-190aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 23.2 kDa |
| AA Sequence : | APMAEGDQKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | VEGFA vascular endothelial growth factor A [ Sus scrofa ] |
| Official Symbol | VEGFA |
| Synonyms | VEGFA; vascular endothelial growth factor A; VPF; VEGF-A; vascular permeability factor; VEGF; |
| Gene ID | 397157 |
| mRNA Refseq | NM_214084 |
| Protein Refseq | NP_999249 |
| ◆ Recombinant Proteins | ||
| VEGF165-12H | Active Recombinant Human VEGF165 Protein | +Inquiry |
| VEGFA-549HAF555 | Recombinant Human VEGFA Protein, None-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| VEGFA-25H | Active Recombinant Human VEGF 162 | +Inquiry |
| VEGFA-533H | Recombinant Human VEGFA Protein | +Inquiry |
| Vegfa-199V | Active Recombinant Rat Vegf165 Protein | +Inquiry |
| ◆ Native Proteins | ||
| VEGFA-31701TH | Native Human VEGFA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VEGFA-1427HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-974HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-655HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
| VEGFA-522RCL | Recombinant Rat VEGFA cell lysate | +Inquiry |
| VEGFA-727HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *
