Recombinant Rabbit CXCL9 protein, His-SUMO-tagged
| Cat.No. : | CXCL9-2777R |
| Product Overview : | Recombinant Rabbit CXCL9 protein(U3KNX2)(23-124aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rabbit |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 23-124aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 27.5 kDa |
| AA Sequence : | SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| Cxcl9-2776M | Recombinant Mouse Cxcl9 protein, His-tagged | +Inquiry |
| CXCL9-1112R | Recombinant Rhesus monkey CXCL9 Protein, His-tagged | +Inquiry |
| Cxcl9-1981M | Recombinant Mouse Cxcl9 protein, His & T7-tagged | +Inquiry |
| CXCL9-167H | Recombinant Human X-C motif chemokine ligand 9 Protein, Tag Free | +Inquiry |
| CXCL9-3399H | Recombinant Human CXCL9 protein(Thr23-Thr125) | +Inquiry |
| ◆ Native Proteins | ||
| CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL9-7165HCL | Recombinant Human CXCL9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL9 Products
Required fields are marked with *
My Review for All CXCL9 Products
Required fields are marked with *



