Recombinant Rabbit CXCL9 protein, His-SUMO-tagged
Cat.No. : | CXCL9-2777R |
Product Overview : | Recombinant Rabbit CXCL9 protein(U3KNX2)(23-124aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 23-124aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.5 kDa |
AA Sequence : | SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
CXCL9-849B | Recombinant Bovine CXCL9 protein | +Inquiry |
CXCL9-345H | Active Recombinant Human Chemokine (C-X-C Motif) Ligand 9, MIgG2a Fc-tagged | +Inquiry |
CXCL9-135B | Recombinant Bovine Chemokine (C-X-C motif) Ligand 9 | +Inquiry |
CXCL9-346H | Active Recombinant Mouse Chemokine (C-X-C Motif) Ligand 9, HIgG1 Fc-tagged | +Inquiry |
CXCL9-2300HF | Recombinant Full Length Human CXCL9 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL9-7165HCL | Recombinant Human CXCL9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL9 Products
Required fields are marked with *
My Review for All CXCL9 Products
Required fields are marked with *
0
Inquiry Basket