Recombinant Rabbit PDGFB Protein
Cat.No. : | PDGFB-99R |
Product Overview : | The Rabbit PDGF-BB recombinant protein without tag was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | Yeast |
Description : | PDGF is one of the numerous growth factors that regulate cell growth and division. It plays a significant role in angiogenesis. Platelet-derived growth factor is a dimeric glycoprotein composed of two A (-AA) or two B (-BB) chains or a combination of the two (-AB). Though PDGF is synthesized, stored (in the alpha granules of platelets), and released by platelets upon activation, it is also produced by numerous cells including smooth muscle cells, activated macrophages, and endothelial cells. |
Molecular Mass : | 12.2 kDa |
AA Sequence : | SLGSPTAAAEPAVIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRHVQCRPTQVQLRPVQVRKIEIVRKKPTFKKATVTLEDHLACKCETVAGVRPA(109) |
Applications : | The Rabbit PDGF-BB endotoxin-free recombinant protein can be used in cell culture, as an PDGF-BB ELISA Standard, and as a Western Blot Control. |
Gene Name | PDGFB platelet derived growth factor subunit B [ Oryctolagus cuniculus (rabbit) ] |
Official Symbol | PDGFB |
Synonyms | PDGFB; platelet derived growth factor subunit B; platelet-derived growth factor subunit B; platelet-derived growth factor beta polypeptide |
Gene ID | 100358772 |
mRNA Refseq | XM_07342088 |
Protein Refseq | XP_017197577 |
◆ Recombinant Proteins | ||
PDGFB-5843C | Recombinant Chicken PDGFB | +Inquiry |
PDGFB-58H | Recombinant Human PDGFB, His-tagged | +Inquiry |
PDGFB-171H | Active Recombinant Human PDGFB protein, Low Endotoxin | +Inquiry |
PDGFB-30560TH | Recombinant Human PDGFB | +Inquiry |
PDGFB-12568M | Recombinant Mouse PDGFB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFB-1321HCL | Recombinant Human PDGFB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFB Products
Required fields are marked with *
My Review for All PDGFB Products
Required fields are marked with *