Recombinant Rat Alpi protein(21-511aa), His-tagged
| Cat.No. : | Alpi-654R |
| Product Overview : | Recombinant Rat Alpi protein(P15693)(21-511aa), fused with N-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 21-511aa |
| Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Bio-activity : | Unit Definition: One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-phenylphosphate(pNPP), in 1 minute at 37°C, pH10.0. The specific activity is >10370.37 U/mg. |
| Molecular Mass : | 55.9 kDa |
| Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN |
| Gene Name | Alpi alkaline phosphatase, intestinal [ Rattus norvegicus ] |
| Official Symbol | Alpi |
| Synonyms | ALPI; alkaline phosphatase, intestinal; intestinal-type alkaline phosphatase 1; IAP-1; IAP-I; intestinal alkaline phosphatase 1; intestinal alkaline phosphatase I IAP-I; Alkaline phosphatase 1, intestinal, defined by SSR; Alp1; S51097; |
| Gene ID | 24197 |
| mRNA Refseq | NM_022665 |
| Protein Refseq | NP_073156 |
| ◆ Recombinant Proteins | ||
| ALPI-1326H | Recombinant Human ALPI Protein (20-503 aa), His-tagged | +Inquiry |
| ALPI-3670H | Recombinant Human ALPI protein, rFc-tagged | +Inquiry |
| ALPI-514H | Active Recombinant Human ALPI Protein, His-tagged | +Inquiry |
| Alpi-1575M | Recombinant Mouse Alpi protein, His-tagged | +Inquiry |
| ALPI-4636H | Recombinant Human ALPI protein, His-Flag-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ALPI-5B | Active Native Bovine Alkaline Phosphatase | +Inquiry |
| IAP-8323C | Active Native Bovine IAP | +Inquiry |
| ALPI-8348B | Native Bovine ALPI | +Inquiry |
| BIAP-76B | Native Bovine Intestinal Alkaline Phosphatase | +Inquiry |
| ALPI-8341C | Native Calf ALPI | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ALPI-471HKCL | Human ALPI Knockdown Cell Lysate | +Inquiry |
| ALPI-1596HCL | Recombinant Human ALPI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Alpi Products
Required fields are marked with *
My Review for All Alpi Products
Required fields are marked with *
