Recombinant Rat C5 protein, His&Myc-tagged
| Cat.No. : | C5-2612R |
| Product Overview : | Recombinant Rat C5 protein(P08650)(1-77aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-77aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 14.0 kDa |
| AA Sequence : | DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | C5 complement component 5 [ Rattus norvegicus ] |
| Official Symbol | C5 |
| Synonyms | C5; complement component 5; Hc; C5a; |
| Gene ID | 25397 |
| ◆ Recombinant Proteins | ||
| C5-502H | Recombinant Human C5 protein, GST-tagged | +Inquiry |
| C5-9288H | Recombinant Human C5 protein (R885H), His-tagged | +Inquiry |
| C5-345H | Recombinant Human C5 Protein, His-tagged | +Inquiry |
| C5-0277H | Recombinant Human C5 Protein (Thr678-Arg751), GST-tagged | +Inquiry |
| C5-1940M | Recombinant Mouse C5 protein, Biotinylated | +Inquiry |
| ◆ Native Proteins | ||
| C5-53H | Native Human Complement C5 | +Inquiry |
| C5-10540H | Active Native Human C5 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C5-8020HCL | Recombinant Human C5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C5 Products
Required fields are marked with *
My Review for All C5 Products
Required fields are marked with *



