Recombinant Rat Cd74 protein, His-tagged
Cat.No. : | Cd74-2672R |
Product Overview : | Recombinant Rat Cd74 protein(P10247)(57-280aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 57-280aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.5 kDa |
AA Sequence : | QQQGRLDKLTVTSQNLQLENLRMKLPKSAKPVSPMRMATPLLMRPLSMDNMLQAPVKNVTKYGNMTQDHVMHLLTKSGPVNYPQLKGSFPENLKHLKNSMNGLDWKVFESWMKQWLLFEMSKNSLEEKQPTQTPPKVLTKCQEEVSHIPDVHPGAFRPKCDENGNYMPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDPSSGLGVTKQDMGQMFL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Cd74 Cd74 molecule, major histocompatibility complex, class II invariant chain [ Rattus norvegicus ] |
Official Symbol | Cd74 |
Synonyms | CD74; Cd74 molecule, major histocompatibility complex, class II invariant chain; H-2 class II histocompatibility antigen gamma chain; ii; ia antigen-associated invariant chain; MHC class II-associated invariant chain; INVG34; |
Gene ID | 25599 |
mRNA Refseq | NM_013069 |
Protein Refseq | NP_037201 |
◆ Recombinant Proteins | ||
Cd74-641M | Active Recombinant Mouse Cd74 Protein, HA-tagged | +Inquiry |
CD74-170H | Recombinant Human CD74 Protein, His-tagged | +Inquiry |
CD74-151H | Recombinant Human CD74 Protein, DYKDDDDK-tagged | +Inquiry |
CD74-9493M | Recombinant Mouse CD74, His-tagged | +Inquiry |
CD74-2232H | Active Recombinant Human CD74, HA-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD74-2603HCL | Recombinant Human CD74 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cd74 Products
Required fields are marked with *
My Review for All Cd74 Products
Required fields are marked with *
0
Inquiry Basket