Recombinant Rat Cd74 protein, His-tagged
| Cat.No. : | Cd74-2672R |
| Product Overview : | Recombinant Rat Cd74 protein(P10247)(57-280aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 57-280aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 29.5 kDa |
| AA Sequence : | QQQGRLDKLTVTSQNLQLENLRMKLPKSAKPVSPMRMATPLLMRPLSMDNMLQAPVKNVTKYGNMTQDHVMHLLTKSGPVNYPQLKGSFPENLKHLKNSMNGLDWKVFESWMKQWLLFEMSKNSLEEKQPTQTPPKVLTKCQEEVSHIPDVHPGAFRPKCDENGNYMPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDPSSGLGVTKQDMGQMFL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Cd74 Cd74 molecule, major histocompatibility complex, class II invariant chain [ Rattus norvegicus ] |
| Official Symbol | Cd74 |
| Synonyms | CD74; Cd74 molecule, major histocompatibility complex, class II invariant chain; H-2 class II histocompatibility antigen gamma chain; ii; ia antigen-associated invariant chain; MHC class II-associated invariant chain; INVG34; |
| Gene ID | 25599 |
| mRNA Refseq | NM_013069 |
| Protein Refseq | NP_037201 |
| ◆ Recombinant Proteins | ||
| Cd74-7854M | Recombinant Mouse Cd74 protein, His-tagged | +Inquiry |
| CD74-2230H | Recombinant Human CD74, GST-Tagged | +Inquiry |
| Cd74-6872R | Recombinant Rat Cd74 protein, His & GST-tagged | +Inquiry |
| Cd74-1231M | Recombinant Mouse Cd74 Protein, MYC/DDK-tagged | +Inquiry |
| CD74-2229H | Recombinant Human CD74 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD74-2603HCL | Recombinant Human CD74 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd74 Products
Required fields are marked with *
My Review for All Cd74 Products
Required fields are marked with *



