Recombinant Rat Ctsd protein, His&Myc-tagged
| Cat.No. : | Ctsd-4222R |
| Product Overview : | Recombinant Rat Ctsd protein(P24268)(65-407aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 65-407aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 45.2 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | EPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDLGGIKVEKQIFGEATKQPGVVFIAAKFDGILGMGYPFISVNKVLPVFDNLMKQKLVEKNIFSFYLNRDPTGQPGGELMLGGTDSRYYHGELSYLNVTRKAYWQVHMDQLEVGSELTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQGEYMIPCEKVSSLPIITFKLGGQNYELHPEKYILKVSQAGKTICLSGFMGMDIPPPSGPLWILGDVFIGCYYTVFDREYNRVGFAKAATL |
| Gene Name | Ctsd cathepsin D [ Rattus norvegicus ] |
| Official Symbol | Ctsd |
| Synonyms | CTSD; cathepsin D; |
| Gene ID | 171293 |
| mRNA Refseq | NM_134334 |
| Protein Refseq | NP_599161 |
| ◆ Recombinant Proteins | ||
| CTSD-11684H | Recombinant Human CTSD, GST-tagged | +Inquiry |
| CTSD-913R | Recombinant Rhesus Macaque CTSD Protein, His (Fc)-Avi-tagged | +Inquiry |
| CTSD-2758H | Recombinant Human CTSD protein, GST-tagged | +Inquiry |
| CTSD-6732C | Recombinant Chicken CTSD | +Inquiry |
| CTSD-435C | Recombinant Cricetulus Griseus CTSD Protein (65-408 aa), His-SUMO-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
| CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
| CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
| CTSD-27858TH | Native Human CTSD | +Inquiry |
| CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTSD-3023MCL | Recombinant Mouse CTSD cell lysate | +Inquiry |
| CTSD-1735HCL | Recombinant Human CTSD cell lysate | +Inquiry |
| CTSD-130HKCL | Human CTSD Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ctsd Products
Required fields are marked with *
My Review for All Ctsd Products
Required fields are marked with *



