Recombinant Rat Ctsd protein, His&Myc-tagged
Cat.No. : | Ctsd-4222R |
Product Overview : | Recombinant Rat Ctsd protein(P24268)(65-407aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 65-407aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | EPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDLGGIKVEKQIFGEATKQPGVVFIAAKFDGILGMGYPFISVNKVLPVFDNLMKQKLVEKNIFSFYLNRDPTGQPGGELMLGGTDSRYYHGELSYLNVTRKAYWQVHMDQLEVGSELTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQGEYMIPCEKVSSLPIITFKLGGQNYELHPEKYILKVSQAGKTICLSGFMGMDIPPPSGPLWILGDVFIGCYYTVFDREYNRVGFAKAATL |
Gene Name | Ctsd cathepsin D [ Rattus norvegicus ] |
Official Symbol | Ctsd |
Synonyms | CTSD; cathepsin D; |
Gene ID | 171293 |
mRNA Refseq | NM_134334 |
Protein Refseq | NP_599161 |
◆ Recombinant Proteins | ||
CTSD-1884H | Recombinant Human CTSD Protein (Arg23-Gln161), N-His tagged | +Inquiry |
CTSD-90H | Recombinant Human Cathepsin D | +Inquiry |
CTSD-2758H | Recombinant Human CTSD protein, GST-tagged | +Inquiry |
CTSD-877H | Recombinant Human CTSD Protein, His-tagged | +Inquiry |
Ctsd-280M | Recombinant Mouse Ctsd, His tagged | +Inquiry |
◆ Native Proteins | ||
CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
CTSD-27858TH | Native Human CTSD | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSD-1735HCL | Recombinant Human CTSD cell lysate | +Inquiry |
CTSD-3023MCL | Recombinant Mouse CTSD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ctsd Products
Required fields are marked with *
My Review for All Ctsd Products
Required fields are marked with *
0
Inquiry Basket