Recombinant Cricetulus Griseus CTSD Protein (65-408 aa), His-SUMO-tagged
Cat.No. : | CTSD-435C |
Product Overview : | Recombinant Cricetulus Griseus CTSD Protein (65-408 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cricetulus Griseus |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 65-408 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 53.3 kDa |
AA Sequence : | GPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSSTFVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSEQPGGLKVEKQIFGEAIKQPGITFIAAKFDGILGMGYPSISVNNVVPVFDNLMQQKLVEKNIFSFFLNRDPTGQPGGELMLGGIDSKYYEGELSYLNVTRKAYWQVHMDQLDVANGLTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQGEYMIPCEKVSSLPSVTLKLGGKDYELSPSKYVLKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGTYYTVFDRDNNRVGFAKAATL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
◆ Recombinant Proteins | ||
Ctsd-2369M | Recombinant Mouse Ctsd Protein, His-tagged | +Inquiry |
Ctsd-280M | Recombinant Mouse Ctsd, His tagged | +Inquiry |
CTSD-913R | Recombinant Rhesus Macaque CTSD Protein, His (Fc)-Avi-tagged | +Inquiry |
Ctsd-4222R | Recombinant Rat Ctsd protein, His&Myc-tagged | +Inquiry |
CTSD-2103H | Recombinant Human CTSD Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CTSD-27858TH | Native Human CTSD | +Inquiry |
CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSD-3023MCL | Recombinant Mouse CTSD cell lysate | +Inquiry |
CTSD-1735HCL | Recombinant Human CTSD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSD Products
Required fields are marked with *
My Review for All CTSD Products
Required fields are marked with *
0
Inquiry Basket