Recombinant Rat IL12 protein, His-tagged
| Cat.No. : | IL12-26R |
| Product Overview : | Recombinant Rat Interleukin-12 is produced in Mammalian expression system and the target gene encoding Met23-Ser335(p40)&Arg23-Ser215(p35) is expressed with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | Mammalian Cells |
| Tag : | His |
| Protein Length : | 23-335;23-215 a.a. |
| Description : | Interleukin 12 (IL-12) is the founding member of the IL-12 family of heterodimeric cytokines, which have important immunological functions. IL-12 is composed of two disulfide-linkedsubunits of 35 kDa and 40 kDa, respectively. The 35 kDa subunit (p35) is an α-helical protein homologous to IL-6 and GCSF.The 40 kDa subunit(p40) contains one fibronectin type III and one Ig C2-like domain, and has a high degree of structural homology to type I cytokine receptors. Whereas p35 subunit is unique to IL-12,the p40 subunit is also utilized in IL-23.Mature rat p35 is a 194 amino acids (aa) protein that is secreted as a heterodimer linked to p40. It contains three potential N-linked glycosylation sites and shares 86%, and 58% aa sequence identity with mouse and human p35, respectively. Mature rat p40 contains 313 aa and can exist in multiple forms, including monomer, homodimer, heterodimer linked to p19 (forming IL23), and heterodimer linked to p35 (forming IL-12). IL12 facilitates hematopoietic stem cell proliferation, induces NK cell proliferation, and potentiates the expansion and late activation of Th1 CD4+ T cells. |
| Form : | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
| AA Sequence : | MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGRASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRSHHHHHH&RVIPVSGPAKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACLPLELHKNESCLATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQSHNHQQITLDRNMLMAIDELMRSLNHSGETLHQKAPMGEADPYRVKMKLCILLHAFSTRVMTINRVMNYLSSSHHHHHH |
| Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | interleukin 12A [ Rattus norvegicus ] |
| Official Symbol | IL12A |
| Synonyms | Interleukin-12; IL-12; IL12A |
| Gene ID | 84405 |
| mRNA Refseq | NM_053390.1 |
| Protein Refseq | NP_445842.1 |
| UniProt ID | Q9R103 |
| ◆ Recombinant Proteins | ||
| IL12-002M | Active Recombinant Mouse IL12, HIgG1 Fc-tagged | +Inquiry |
| IL12-249H | Recombinant Human interleukin 12 Protein, His tagged | +Inquiry |
| IL12-001H | Active Recombinant Human IL12, HIgG1 Fc-tagged | +Inquiry |
| IL12-417H | Active Recombinant Human IL12 protein | +Inquiry |
| IL12-4327H | Recombinant Human IL12A&IL12B heterodimer protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL12 Products
Required fields are marked with *
My Review for All IL12 Products
Required fields are marked with *
