Recombinant Human IL12A&IL12B heterodimer protein
Cat.No. : | IL12-4327H |
Product Overview : | Recombinant Human IL12A&IL12B heterodimer protein was expressed in CHO. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | Non |
Form : | Liquid in sterile 50mM PB, 300mM NaCl, pH7.0. |
Bio-activity : | Measured by its ability to enhance IFN-gamma secretion in NK-92 human natural killer lymphoma cells. The ED50 for this effect is 3.486ng/ml. |
Molecular Mass : | The protein has a calculated MW of 56.9 kDa. |
AA Sequence : | p35 Subunit: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS p40 Subunit: ELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
Endotoxin : | <1.0 EU per 1μg (determined by the LAL method) |
Purity : | > 90% as determined by SDS-PAGE; > 95% as determined by HPLC. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.5 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | IL12A interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35) [ Homo sapiens ] |
Official Symbol | IL12A |
Synonyms | IL12A; interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35); NKSF1; interleukin-12 subunit alpha; CLMF; cytotoxic lymphocyte maturation factor 1; p35; IL 12; subunit p35; IL 12A; IL35 subunit; interleukin 12; interleukin 12 alpha chain; natural killer cell stimulatory factor 1; 35 kD subunit; NF cell stimulatory factor chain 1; NFSK; CLMF p35; IL-12 subunit p35; IL-12, subunit p35; interleukin 12, p35; interleukin-12 alpha chain; NK cell stimulatory factor chain 1; cytotoxic lymphocyte maturation factor 1, p35; cytotoxic lymphocyte maturation factor 35 kDa subunit; natural killer cell stimulatory factor 1, 35 kD subunit; P35; IL-12A; |
Gene ID | 3592 |
mRNA Refseq | NM_000882 |
Protein Refseq | NP_000873 |
MIM | 161560 |
UniProt ID | P29459 |
◆ Recombinant Proteins | ||
Il12b-175M | Active Recombinant Mouse interleukin 12 Protein, Flag tagged | +Inquiry |
IL12-21M | Recombinant Mouse Interleukin 12 Protein, His tagged | +Inquiry |
IL12-28M | Active Recombinant Mouse IL12 protein, His-tagged | +Inquiry |
IL12-4327H | Recombinant Human IL12A&IL12B heterodimer protein | +Inquiry |
IL12-417H | Active Recombinant Human IL12 protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL12 Products
Required fields are marked with *
My Review for All IL12 Products
Required fields are marked with *
0
Inquiry Basket