Recombinant Rat MMP12 Protein
Cat.No. : | MMP12-01R |
Product Overview : | Recombinant Rat MMP12 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Protein Length : | 102-465 a.a. |
Description : | Predicted to enable several functions, including core promoter sequence-specific DNA binding activity; metal ion binding activity; and metalloendopeptidase activity. Involved in several processes, including positive regulation of epithelial cell proliferation; regulation of trophoblast cell migration; and response to hypoxia. Predicted to be located in cytoplasm; extracellular space; and nucleus. Used to study crescentic glomerulonephritis. Biomarker of anti-basement membrane glomerulonephritis and crescentic glomerulonephritis. Human ortholog(s) of this gene implicated in Barrett's esophagus; artery disease (multiple); coronary aneurysm; esophagus adenocarcinoma; and multiple sclerosis. Orthologous to human MMP12 (matrix metallopeptidase 12). |
Form : | PBS, pH 7.4, 0.35 M Arginine, 10% Glycerol. |
Molecular Mass : | 43 kDa |
AA Sequence : | MRSRWMKRYLTYRIYNYTPDMKRADVDYIFQKAFQVWSDVTPLRFRKIHKGEADITILFAFGDHGDFYDFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLRHSNNPKSIMYPTYRYLHPNTFRLSADDIHSIQSLYGAPVKNPSLTNPGSPPSTVCHQSLSFDAVTTVGDKIFFFKDWFFWWRLPGSPATNITSISSMWPTIPSGIQAAYEIGGRNQLFLFKDEKYWLINNLVPEPHYPRSIHSLGFPASVKKIDAAVFDPLRQKVYFFVDKQYWRYDVRQELMDAAYPKLISTHFPGIRPKIDAVLYFKRHYYIFQGAYQLEYDPLLDRVTKTLSSTSWFGCLRHHHHHH |
Purity : | > 90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.111mg/ml |
Gene Name | Mmp12 matrix metallopeptidase 12 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | Mmp12 |
Synonyms | ME; HME; MME; MMP-12 |
Gene ID | 117033 |
mRNA Refseq | NM_053963 |
Protein Refseq | NP_446415 |
UniProt ID | Q63341 |
◆ Recombinant Proteins | ||
Mmp12-600M | Recombinant Mouse Mmp12 Protein, His-tagged | +Inquiry |
Mmp12-534M | Active Recombinant Mouse Mmp12 | +Inquiry |
MMP12-01R | Recombinant Rat MMP12 Protein | +Inquiry |
MMP12-28717TH | Recombinant Human MMP12, His-tagged | +Inquiry |
Mmp12-10592M | Recombinant Mouse Mmp12 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP12-4281HCL | Recombinant Human MMP12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP12 Products
Required fields are marked with *
My Review for All MMP12 Products
Required fields are marked with *
0
Inquiry Basket