Recombinant Rat MMP12 Protein

Cat.No. : MMP12-01R
Product Overview : Recombinant Rat MMP12 Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Protein Length : 102-465 a.a.
Description : Predicted to enable several functions, including core promoter sequence-specific DNA binding activity; metal ion binding activity; and metalloendopeptidase activity. Involved in several processes, including positive regulation of epithelial cell proliferation; regulation of trophoblast cell migration; and response to hypoxia. Predicted to be located in cytoplasm; extracellular space; and nucleus. Used to study crescentic glomerulonephritis. Biomarker of anti-basement membrane glomerulonephritis and crescentic glomerulonephritis. Human ortholog(s) of this gene implicated in Barrett's esophagus; artery disease (multiple); coronary aneurysm; esophagus adenocarcinoma; and multiple sclerosis. Orthologous to human MMP12 (matrix metallopeptidase 12).
Form : PBS, pH 7.4, 0.35 M Arginine, 10% Glycerol.
Molecular Mass : 43 kDa
AA Sequence : MRSRWMKRYLTYRIYNYTPDMKRADVDYIFQKAFQVWSDVTPLRFRKIHKGEADITILFAFGDHGDFYDFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLRHSNNPKSIMYPTYRYLHPNTFRLSADDIHSIQSLYGAPVKNPSLTNPGSPPSTVCHQSLSFDAVTTVGDKIFFFKDWFFWWRLPGSPATNITSISSMWPTIPSGIQAAYEIGGRNQLFLFKDEKYWLINNLVPEPHYPRSIHSLGFPASVKKIDAAVFDPLRQKVYFFVDKQYWRYDVRQELMDAAYPKLISTHFPGIRPKIDAVLYFKRHYYIFQGAYQLEYDPLLDRVTKTLSSTSWFGCLRHHHHHH
Purity : > 90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.111mg/ml
Gene Name Mmp12 matrix metallopeptidase 12 [ Rattus norvegicus (Norway rat) ]
Official Symbol Mmp12
Synonyms ME; HME; MME; MMP-12
Gene ID 117033
mRNA Refseq NM_053963
Protein Refseq NP_446415
UniProt ID Q63341

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MMP12 Products

Required fields are marked with *

My Review for All MMP12 Products

Required fields are marked with *

0
cart-icon
0
compare icon