| Species : |
Rat |
| Source : |
E.coli |
| Protein Length : |
102-465 a.a. |
| Description : |
Predicted to enable several functions, including core promoter sequence-specific DNA binding activity; metal ion binding activity; and metalloendopeptidase activity. Involved in several processes, including positive regulation of epithelial cell proliferation; regulation of trophoblast cell migration; and response to hypoxia. Predicted to be located in cytoplasm; extracellular space; and nucleus. Used to study crescentic glomerulonephritis. Biomarker of anti-basement membrane glomerulonephritis and crescentic glomerulonephritis. Human ortholog(s) of this gene implicated in Barrett's esophagus; artery disease (multiple); coronary aneurysm; esophagus adenocarcinoma; and multiple sclerosis. Orthologous to human MMP12 (matrix metallopeptidase 12). |
| Form : |
PBS, pH 7.4, 0.35 M Arginine, 10% Glycerol. |
| Molecular Mass : |
43 kDa |
| AA Sequence : |
MRSRWMKRYLTYRIYNYTPDMKRADVDYIFQKAFQVWSDVTPLRFRKIHKGEADITILFAFGDHGDFYDFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLRHSNNPKSIMYPTYRYLHPNTFRLSADDIHSIQSLYGAPVKNPSLTNPGSPPSTVCHQSLSFDAVTTVGDKIFFFKDWFFWWRLPGSPATNITSISSMWPTIPSGIQAAYEIGGRNQLFLFKDEKYWLINNLVPEPHYPRSIHSLGFPASVKKIDAAVFDPLRQKVYFFVDKQYWRYDVRQELMDAAYPKLISTHFPGIRPKIDAVLYFKRHYYIFQGAYQLEYDPLLDRVTKTLSSTSWFGCLRHHHHHH |
| Purity : |
> 90% |
| Storage : |
Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : |
0.111mg/ml |
