Recombinant Rat PLA2G5 Protein (21-137 aa), His-SUMO-tagged

Cat.No. : PLA2G5-722R
Product Overview : Recombinant Rat PLA2G5 Protein (21-137 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His&SUMO
Protein Length : 21-137 aa
Description : PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes L-alpha-palmitoyl-2-oleoyl phosphatidylcholine more efficiently than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 29.8 kDa
AA Sequence : GLLELKSMIEKVTGKNAVKNYGFYGCYCGWGGHGTPKDGTDWCCRMHDRCYGLLEEKHCAIRTQSYDYRFTQDLVICEHDSFCPVRLCACDRKLVYCLRRNLWSYNRLYQYYPNFLC
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name Pla2g5 phospholipase A2, group V [ Rattus norvegicus ]
Official Symbol PLA2G5
Synonyms PLA2G5; PLA2-10; MGC93513;
Gene ID 29354
mRNA Refseq NM_017174
Protein Refseq NP_058870
UniProt ID P51433

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLA2G5 Products

Required fields are marked with *

My Review for All PLA2G5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon