Recombinant Rat S100A4 Protein (2-101 aa), His-Myc-tagged
Cat.No. : | S100A4-2599R |
Product Overview : | Recombinant Rat S100A4 Protein (2-101 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-101 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 18.6 kDa |
AA Sequence : | ARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | S100a4 S100 calcium-binding protein A4 [ Rattus norvegicus ] |
Official Symbol | S100A4 |
Synonyms | S100A4; protein S100-A4; P9K; metastasin; calvasculin; 42A; 18A2; CAPL; MTS1; P9ka; PEL98; RNP9KA; |
Gene ID | 24615 |
mRNA Refseq | NM_012618 |
Protein Refseq | NP_036750 |
UniProt ID | P05942 |
◆ Recombinant Proteins | ||
S100a4-5105M | Recombinant Mouse S100 calcium Binding Protein A4, His-tagged | +Inquiry |
S100a4-3542M | Recombinant Mouse S100a4, His-tagged | +Inquiry |
S100a4-7323M | Recombinant Full Length Mouse S100a4 Protein, His-tagged | +Inquiry |
S100A4-89H | Recombinant Human S100A4 | +Inquiry |
S100A4-2489H | Recombinant Full Length Human S100A4, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A4-001MCL | Recombinant Mouse S100A4 cell lysate | +Inquiry |
S100A4-2859HCL | Recombinant Human S100A4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100A4 Products
Required fields are marked with *
My Review for All S100A4 Products
Required fields are marked with *
0
Inquiry Basket