Recombinant Mouse Sost Protein, His-tagged
Cat.No. : | Sost-010M |
Product Overview : | Recombinant mouse SOST/Sclerostin, fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Description : | Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation. |
Form : | Liquid |
Molecular Mass : | 21.9 kDa |
AA Sequence : | QGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -89 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | Sost sclerostin [ Mus musculus (house mouse) ] |
Official Symbol | Sost |
Synonyms | Sost; sclerostin; 5430411E23Rik; sclerostin |
Gene ID | 74499 |
mRNA Refseq | NM_024449 |
Protein Refseq | NP_077769.4 |
UniProt ID | Q99P68 |
◆ Recombinant Proteins | ||
SOST-215H | Recombinant Human SOST Protein, GLN24-TYR213, Tag Free, Biotinylated | +Inquiry |
SOST-2669R | Recombinant Rat SOST Protein (29-213 aa), His-Myc-tagged | +Inquiry |
Sost-753M | Recombinant Mouse Sost protein, His-tagged | +Inquiry |
SOST-5673R | Recombinant Rat SOST Protein | +Inquiry |
SOST-270H | Active Recombinant Human SOST protein, His-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOST-2846HCL | Recombinant Human SOST cell lysate | +Inquiry |
SOST-2251RCL | Recombinant Rat SOST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sost Products
Required fields are marked with *
My Review for All Sost Products
Required fields are marked with *