Recombinant Mouse Sost Protein, His-tagged

Cat.No. : Sost-010M
Product Overview : Recombinant mouse SOST/Sclerostin, fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Description : Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation.
Form : Liquid
Molecular Mass : 21.9 kDa
AA Sequence : QGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -89 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name Sost sclerostin [ Mus musculus (house mouse) ]
Official Symbol Sost
Synonyms Sost; sclerostin; 5430411E23Rik; sclerostin
Gene ID 74499
mRNA Refseq NM_024449
Protein Refseq NP_077769.4
UniProt ID Q99P68

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Sost Products

Required fields are marked with *

My Review for All Sost Products

Required fields are marked with *

0
cart-icon