Recombinant Mouse Sost Protein, His-tagged

• Cat.No.: Sost-010M
• Product Overview: Recombinant mouse SOST/Sclerostin, fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Description: Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation.
• Form: Liquid
• Molecular Mass: 21.9 kDa
• AA Sequence: QGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -89 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: Sost sclerostin [ Mus musculus (house mouse) ]
• Official Symbol: Sost
• Synonyms: Sost; sclerostin; 5430411E23Rik; sclerostin
• Gene ID: 74499
• mRNA Refseq: NM_024449
• Protein Refseq: NP_077769.4
• UniProt ID: Q99P68