Recombinant Rat Syt1 Full Length Transmembrane protein, His-tagged
Cat.No. : | Syt1-2156R |
Product Overview : | Recombinant Rat Syt1 protein(P21707)(1-421aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-421aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 53.5 kDa |
AA Sequence : | MVSASHPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Syt1 synaptotagmin I [ Rattus norvegicus ] |
Official Symbol | Syt1 |
Synonyms | SYT1; synaptotagmin I; synaptotagmin-1; sytI; synaptotagmin 1; P65; |
Gene ID | 25716 |
mRNA Refseq | NM_001033680 |
Protein Refseq | NP_001028852 |
◆ Recombinant Proteins | ||
SYT1-3551H | Recombinant Human Synaptotagmin 1, His-tagged | +Inquiry |
SYT1-31491TH | Recombinant Human SYT1, His-tagged | +Inquiry |
SYT1-5875R | Recombinant Rat SYT1 Protein | +Inquiry |
SYT1-31492TH | Recombinant Human SYT1 | +Inquiry |
SYT1-450H | Recombinant Human SYT1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Syt1 Products
Required fields are marked with *
My Review for All Syt1 Products
Required fields are marked with *
0
Inquiry Basket