Recombinant Rat Syt1 Full Length Transmembrane protein, His-tagged
| Cat.No. : | Syt1-2156R | 
| Product Overview : | Recombinant Rat Syt1 protein(P21707)(1-421aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Rat | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 1-421aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.  | 
                                
| Molecular Mass : | 53.5 kDa | 
| AA Sequence : | MVSASHPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK | 
| Purity : | Greater than 85% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. | 
| Gene Name | Syt1 synaptotagmin I [ Rattus norvegicus ] | 
| Official Symbol | Syt1 | 
| Synonyms | SYT1; synaptotagmin I; synaptotagmin-1; sytI; synaptotagmin 1; P65; | 
| Gene ID | 25716 | 
| mRNA Refseq | NM_001033680 | 
| Protein Refseq | NP_001028852 | 
| ◆ Recombinant Proteins | ||
| RFL33856MF | Recombinant Full Length Mouse Synaptotagmin-1(Syt1) Protein, His-Tagged | +Inquiry | 
| Syt1-6256M | Recombinant Mouse Syt1 Protein, Myc/DDK-tagged | +Inquiry | 
| RFL22382HF | Recombinant Full Length Human Synaptotagmin-1(Syt1) Protein, His-Tagged | +Inquiry | 
| SYT1-3552R | Recombinant Rhesus monkey SYT1 protein, His-tagged | +Inquiry | 
| SYT1-3066H | Recombinant Human SYT1 Protein, MYC/DDK-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All Syt1 Products
Required fields are marked with *
My Review for All Syt1 Products
Required fields are marked with *
  
        
    
      
            