Recombinant Rat Unc5b Protein, hIgG/His-tagged

Cat.No. : Unc5b-039R
Product Overview : Recombinant Rat UNC5B/UNC5B, fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Tag : Fc&His
Description : Receptor for netrin required for axon guidance. Mediates axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding. Axon repulsion in growth cones may be caused by its association with DCC that may trigger signaling for repulsion. Functions as netrin receptor that negatively regulates vascular branching during angiogenesis. Mediates retraction of tip cell filopodia on endothelial growth cones in response to netrin. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand. Mediates apoptosis by activating DAPK1. In the absence of NTN1, activates DAPK1 by reducing its autoinhibitory phosphorylation at Ser-308 thereby increasing its catalytic activity.
Form : Liquid
Molecular Mass : 66.0 kDa
AA Sequence : GIDSGGQALPDSFPSAPAEQLPHFLLEPEDAYIVKNKPVELHCRAFPATQIYFKCNGEWVSQKGHVTQESLDEATGLRIREVQIEVSRQQVEELFGLEDYWCQCVAWSSSGTTKSRRAYIRIAYLRKNFDQEPLAKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPAQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQACQKTACTTVCPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCVLNQRTLNDPKSRPLEPSGD
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -118 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name Unc5b unc-5 netrin receptor B [ Rattus norvegicus (Norway rat) ]
Official Symbol Unc5b
Synonyms Unc5b; unc-5 netrin receptor B; Unc5h2; netrin receptor UNC5B; protein unc-5 homolog 2; protein unc-5 homolog B; transmembrane receptor Unc5H2; unc-5 homolog 2; unc-5 homolog B
Gene ID 60630
mRNA Refseq NM_022207
Protein Refseq NP_071543
UniProt ID O08722

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Unc5b Products

Required fields are marked with *

My Review for All Unc5b Products

Required fields are marked with *

0

Inquiry Basket

cartIcon