Recombinant Rat VAMP2 Protein (2-94 aa), His-tagged
Cat.No. : | VAMP2-2420R |
Product Overview : | Recombinant Rat VAMP2 Protein (2-94 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-94 aa |
Description : | Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 14.1 kDa |
AA Sequence : | SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Vamp2 vesicle-associated membrane protein 2 [ Rattus norvegicus ] |
Official Symbol | VAMP2 |
Synonyms | VAMP2; vesicle-associated membrane protein 2; VAMP-2; synaptobrevin-2; SYB; Syb2; RATVAMPB; RATVAMPIR; |
Gene ID | 24803 |
mRNA Refseq | NM_012663 |
Protein Refseq | NP_036795 |
UniProt ID | P63045 |
◆ Recombinant Proteins | ||
VAMP2-9990M | Recombinant Mouse VAMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
VAMP2-4954R | Recombinant Rhesus Macaque VAMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
VAMP2-216H | Recombinant Human VAMP2 Protein, His Tagged | +Inquiry |
RFL367BF | Recombinant Full Length Bovine Vesicle-Associated Membrane Protein 2(Vamp2) Protein, His-Tagged | +Inquiry |
VAMP2-6148R | Recombinant Rat VAMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VAMP2-438HCL | Recombinant Human VAMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VAMP2 Products
Required fields are marked with *
My Review for All VAMP2 Products
Required fields are marked with *