Recombinant Rhesus C-X-C motif chemokine ligand 16 Protein, His&SUMO tagged
| Cat.No. : | CXCL16-255R |
| Product Overview : | Recombinant Rhesus CXCL16 Protein (51-228aa) with N-His&SUMO tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rhesus macaque |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 51-228aa |
| Description : | Enables chemokine activity. Involved in several processes, including positive regulation of cell growth; response to interferon-gamma; and response to tumor necrosis factor. Located in extracellular space. Biomarker of COVID-19 and systemic scleroderma. |
| Tag : | N-His&SUMO |
| Molecular Mass : | 33.24 kDa |
| AA Sequence : | MNWSHPQFEKSSGSSGGHHHHHHGGSGGSGSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIEAHREQIGGNEGTVTGSCHCSKRISSDSPPSAQFMNRLRKHLRAYHHCLHYIRFQLPSWSVCGGSKDPWVRELMSCLDLKECGHAYLGSVAHQEHLPPTSTPISQASEGASSDIRTPTQMLLSILQSTQCPTPPAGSLSLDKELTRPSETTIPTAGHSLGVGLEAGENQKQLKNNAGPTAGTSATVP |
| Purity : | > 85% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | 20 mM Tris-HCl, 0.10 M NaCl, pH8.0 |
| Concentration : | 0.5 mg/mL |
| Gene Name | CXCL16 C-X-C motif chemokine ligand 16 [ Macaca mulatta (Rhesus monkey) ] |
| Official Symbol | CXCL16 |
| Synonyms | CXCL16; C-X-C motif chemokine ligand 16; C-X-C motif chemokine 16 |
| Gene ID | 721566 |
| mRNA Refseq | XM_001117747 |
| Protein Refseq | XP_001117747 |
| UniProt ID | F7AGQ0 |
| ◆ Recombinant Proteins | ||
| Cxcl16-884M | Recombinant Mouse Cxcl16 Protein, His-tagged | +Inquiry |
| CXCL16-2183H | Recombinant Human CXCL16 Protein (Val52-Lys190), N-His tagged | +Inquiry |
| Cxcl16-2095M | Recombinant Mouse Cxcl16 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cxcl16-7650R | Recombinant Rat Cxcl16 protein, His & T7-tagged | +Inquiry |
| CXCL16-881H | Recombinant Human CXCL16 Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CXCL16-253C | Recombinant Cynomolgus CXCL16 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL16-2545MCL | Recombinant Mouse CXCL16 cell lysate | +Inquiry |
| CXCL16-1414RCL | Recombinant Rat CXCL16 cell lysate | +Inquiry |
| CXCL16-842CCL | Recombinant Canine CXCL16 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL16 Products
Required fields are marked with *
My Review for All CXCL16 Products
Required fields are marked with *
