Recombinant Rhesus macaque IL10 Protein, His-tagged

• Cat.No.: IL10-22R
• Product Overview: Recombinant Rhesus macaque IL10(19-178aa) fused with His tag at N-terminal was expressed in Yeast.

Specification

• Species: Rhesus macaque
• Source: Yeast
• Tag: His
• Protein Length: 19-178aa
• Description: IL10 played an important role in many funtions.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 20.7kDa
• AA Sequence: SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Stability: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: IL10 interleukin 10 [ Macaca mulatta ]
• Official Symbol: IL10
• Synonyms: CSIF; IL-10; cytokine synthesis inhibitory factor
• Gene ID: 694931
• mRNA Refseq: NM_001044727
• Protein Refseq: NP_001038192
• UniProt ID: P51496