Recombinant Rhesus macaque IL10 Protein, His-tagged

Cat.No. : IL10-22R
Product Overview : Recombinant Rhesus macaque IL10(19-178aa) fused with His tag at N-terminal was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : Yeast
Tag : His
Protein Length : 19-178aa
Description : IL10 played an important role in many funtions.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 20.7kDa
AA Sequence : SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
Purity : Greater than 90% as determined by SDS-PAGE.
Stability : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name IL10 interleukin 10 [ Macaca mulatta ]
Official Symbol IL10
Synonyms CSIF; IL-10; cytokine synthesis inhibitory factor
Gene ID 694931
mRNA Refseq NM_001044727
Protein Refseq NP_001038192
UniProt ID P51496

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL10 Products

Required fields are marked with *

My Review for All IL10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon