Recombinant Rhesus macaque IL10 Protein, His-tagged
| Cat.No. : | IL10-22R |
| Product Overview : | Recombinant Rhesus macaque IL10(19-178aa) fused with His tag at N-terminal was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rhesus macaque |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 19-178aa |
| Description : | IL10 played an important role in many funtions. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 20.7kDa |
| AA Sequence : | SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Stability : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | IL10 interleukin 10 [ Macaca mulatta ] |
| Official Symbol | IL10 |
| Synonyms | CSIF; IL-10; cytokine synthesis inhibitory factor |
| Gene ID | 694931 |
| mRNA Refseq | NM_001044727 |
| Protein Refseq | NP_001038192 |
| UniProt ID | P51496 |
| ◆ Recombinant Proteins | ||
| IL10-2033H | Recombinant Human IL10 Protein, His-tagged | +Inquiry |
| Il10-006I | Active Recombinant Rat Il10 Protein (160 aa) | +Inquiry |
| IL10-588H | Active Recombinant Human IL10, HIgG1 Fc-tagged, mutant | +Inquiry |
| IL10-0021H | Recombinant Human IL10 Protein | +Inquiry |
| Il10-260I | Active Recombinant Rat Il10 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL10 Products
Required fields are marked with *
My Review for All IL10 Products
Required fields are marked with *
