Recombinant Sheep B2M protein, His&Myc-tagged
| Cat.No. : | B2M-2574S |
| Product Overview : | Recombinant Sheep B2M protein(Q6QAT4)(21-118aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Sheep |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 21-118aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.6 kDa |
| AA Sequence : | IQRIPEVQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVNHVTLTQPKIVKWDRDL |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| B2M-002H | Recombinant Human B2M protein, GST-tagged | +Inquiry |
| B2M-464P | Recombinant Pig B2M protein | +Inquiry |
| B2m-533G | Recombinant Golden hamster B2m protein | +Inquiry |
| B2m-785M | Recombinant Mouse B2m protein, hFc-tagged | +Inquiry |
| B2m-317R | Recombinant Rat B2m Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| B2M-13H | Native Human B2M | +Inquiry |
| B2M-5366H | Native Human Beta-2-Microglobulin | +Inquiry |
| B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| B2M-1550RCL | Recombinant Rat B2M cell lysate | +Inquiry |
| B2M-1656MCL | Recombinant Mouse B2M cell lysate | +Inquiry |
| B2M-1512CCL | Recombinant Cynomolgus B2M cell lysate | +Inquiry |
| B2M-2204HCL | Recombinant Human B2M cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B2M Products
Required fields are marked with *
My Review for All B2M Products
Required fields are marked with *
