Recombinant Swine CCL5
Cat.No. : | CCL5-22S |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | Yeast |
Tag : | Non |
Description : | CCL5, also know as RANTES (regulated and normal T cell expressed and secreted) is a member of the C-C Chemokine Family. There are at least 27 distinct members of the C-C subgroup reported for mammals. RANTES (CCL5) is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes into inflammatory sites. CCL5 plays a role in many disease states, including rheumatoid arthritis, HIV, and cancer. |
Form : | Lyophilized |
Molecular Mass : | 7.9 kDa |
AA Sequence : | SPYASDTTPCCFSYLSRPLPRAHLQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINTLEMS |
Storage : | -20 C |
◆ Recombinant Proteins | ||
CCL5-771H | Recombinant Horse CCL5 protein, His & T7-tagged | +Inquiry |
Ccl5-774M | Recombinant Mouse Ccl5 protein, His & GST-tagged | +Inquiry |
CCL5-147S | Recombinant Swine Chemokine (C-C motif) Ligand 5 | +Inquiry |
CCL5-125H | Recombinant Human Chemokine (C-C Motif) Ligand 5 | +Inquiry |
Ccl5-2040M | Recombinant Mouse Ccl5 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL5-2706HCL | Recombinant Human CCL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL5 Products
Required fields are marked with *
My Review for All CCL5 Products
Required fields are marked with *