Recombinant Swine CCL5
| Cat.No. : | CCL5-22S |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pig |
| Source : | Yeast |
| Tag : | Non |
| Description : | CCL5, also know as RANTES (regulated and normal T cell expressed and secreted) is a member of the C-C Chemokine Family. There are at least 27 distinct members of the C-C subgroup reported for mammals. RANTES (CCL5) is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes into inflammatory sites. CCL5 plays a role in many disease states, including rheumatoid arthritis, HIV, and cancer. |
| Form : | Lyophilized |
| Molecular Mass : | 7.9 kDa |
| AA Sequence : | SPYASDTTPCCFSYLSRPLPRAHLQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINTLEMS |
| Storage : | -20 C |
| ◆ Recombinant Proteins | ||
| CCL5-301H | Recombinant Human CCL5 protein | +Inquiry |
| CCL5-85H | Recombinant Human CCL5, His tagged | +Inquiry |
| CCL5-1081H | Recombinant Human CCL5 Protein (Ser24-Ser91), C-Fc and His tagged | +Inquiry |
| Ccl5-2039M | Active Recombinant Mouse Ccl5 Protein | +Inquiry |
| CCL5-81H | Active Recombinant Human CCL5 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL5-2706HCL | Recombinant Human CCL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL5 Products
Required fields are marked with *
My Review for All CCL5 Products
Required fields are marked with *
