Recombinant Zebrafish IL26 Protein, His-tagged
Cat.No. : | IL26-61Z |
Product Overview : | Recombinant Zebrafish IL26 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zebrafish |
Source : | E.coli |
Tag : | His |
Description : | Is expressed in gill and intestine. Orthologous to human IL26 (interleukin 26). |
Form : | Supplied as a 0.2 μm filtered solution in PBS, 1 mM DTT (pH8.0). |
Molecular Mass : | ~21 kDa |
AA Sequence : | MHHHHHHMRILIPFTLCALLCWSEGHKQEECLKREIRLPMIREMLSMSQDIHKSLPRDNKPFHRILGKLKKCKELNVPDFKRVLEIYDEHVFEKMWDELPTQFIDYFKRLKGIMQNCATEGKPTQSR CAKEKLKKFEQTLMKLQPDGKTKALSEFHSVLLWISSGMDRRKTYKKIH |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.15 mg/ml |
Gene Name | il26 interleukin 26 [ Danio rerio (zebrafish) ] |
Official Symbol | IL26 |
Synonyms | zgc:194942 |
Gene ID | 553971 |
mRNA Refseq | NM_001020799 |
Protein Refseq | NP_001018635 |
UniProt ID | Q5TLE5 |
◆ Recombinant Proteins | ||
IL26-5746HF | Recombinant Full Length Human IL26 Protein, GST-tagged | +Inquiry |
IL26-3564H | Recombinant Human IL26 Protein (Lys22-Gln171), C-His tagged | +Inquiry |
IL26-2932Z | Recombinant Zebrafish IL26 | +Inquiry |
IL26-2446H | Recombinant Human IL26 Protein (22-171 aa), His-B2M-tagged | +Inquiry |
IL26-184H | Recombinant Active Human IL26 Protein, His-tagged(C-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL26-5230HCL | Recombinant Human IL26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL26 Products
Required fields are marked with *
My Review for All IL26 Products
Required fields are marked with *