Active GMP Recombinant Human FGF7 Protein

• Cat.No.: FGF7-01HG
• Product Overview: Active GMP Recombinant Human FGF7 Protein(P21781)(32-194 aa) was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Tag: Non
• Protein Length: 32-194 aa
• Form: PBS, 5% mannitol and 0.01% Tween 80, pH7.4
• Bio-activity: Measured by its ability to induce lL-11 secretion by Saos-2 human osteosarcoma cells. The ED50 for this effect is ≤1 μg/mL.
• Molecular Mass: 18.8 kDa
• AASequence: CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
• Endotoxin: ≤10 EU/mg by the LAL method
• Purity: ≥95%, by SDS-PAGE (under conditions, visualized by Coomassie staining)
• Storage: 36 months at -20°C to -80°C in lyophilized state 6 months at -20°C to -80°C under sterile conditions after reconstitution 7-10 days at 2°C to 8°C under sterile conditions after reconstitution Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended to redissolve in sterile deionized water.

Gene Information

• Gene Name: FGF7 fibroblast growth factor 7 [ Homo sapiens ]
• Official Symbol: FGF7
• Synonyms: FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7
• Gene ID: 2252
• mRNA Refseq: NM_002009
• Protein Refseq: NP_002000
• MIM: 148180
• UniProt ID: P21781