Active GMP Recombinant Human IL9 protein
Cat.No. : | IL9-4324HG |
Product Overview : | Recombinant Human IL9 was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | Interleukin-9 (IL-9) is encoded by the IL9 gene and produced by T-cells and specifically by CD4+ helper cells. IL-9 was originally identified as a cytokine found in the conditioned medium of a human T cell leukemia virus type I (HTLVI) transformed T cell line. It functions through the IL-9 receptor, which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. IL-9 can support the growth of IL-2 independent and IL-4 independent helper T-cells. Human IL-9 has approximately 56 % amino acid sequence identity with murine IL-9. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyper-responsiveness. |
Form : | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human MO7e cells is less than 0.2 ng/ml, corresponding to a specific activity of > 5.0 × 10^6 IU/mg. |
Molecular Mass : | Approximately 14.1 kDa, a single non-glycosylated polypeptide chain containing 126 amino acids. |
AA Sequence : | QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI |
Endotoxin : | Less than 1 EU/µg of rHuIL-9 as determined by LAL method. |
Purity : | > 95 % by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Reconstitution : | Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Quality Statement : | Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | IL9 interleukin 9 [ Homo sapiens (human) ] |
Official Symbol | IL9 |
Synonyms | P40; HP40; IL-9; Cytokine P40, T-cell Growth Factor P40 |
Gene ID | 3578 |
mRNA Refseq | NM_000590.1 |
Protein Refseq | NP_000581.1 |
MIM | 146931 |
UniProt ID | P15248 |
◆ Recombinant Proteins | ||
IL9-67H | Recombinant Human IL9 protein | +Inquiry |
Il9-01M | Active Recombinant Mouse Il9 Protein, His-Tagged | +Inquiry |
Il9-1685R | Recombinant Rat Il9 Protein, His-tagged | +Inquiry |
IL9-151H | Recombinant Human IL9 Protein, DYKDDDDK-tagged | +Inquiry |
Il9-78M | Recombinant Mouse Il9 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL9-618HCL | Recombinant Human IL9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL9 Products
Required fields are marked with *
My Review for All IL9 Products
Required fields are marked with *
0
Inquiry Basket